KEGG   Pedobacter heparinus: Phep_2314Help
Entry
Phep_2314         CDS       T00978                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE domain protein
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
phe  Pedobacter heparinus
Pathway
phe00040  Pentose and glucuronate interconversions
phe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Phep_2314
Enzymes [BR:phe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     Phep_2314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Lactonase Peptidase_S9_N Str_synth
Motif
Other DBs
NCBI-ProteinID: ACU04518
UniProt: C6XYN6
Position
complement(2692991..2693878)
Genome map
AA seq 295 aa AA seqDB search
MRPPFQIDIVSKHRCQLGECPVWDVKKQVICWIDILRGEIHQYSPVDSTHVKLAVPPLTG
SMALCKDGNFIAALRSGISFIDRKTAEIKFISNPETHLPFNRFNEGKCDPEGRFWVGTMS
LTDEEKKGSVYALDEKLKIDKKITEVSISNGLAWSGDKKTLYYIDTPTFEIVSYDYDSST
GTITNRKVVIKVSEKDGYPDGMTIDNEGMLWVAHWDGWQITRWDPINGEKLLSIPMPVAR
VTSCTFGGKNLNDLYVTSARTGLSTSDLKKQPEAGAIFVIRNSSFKGLPAIEFNY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccaccttttcaaatagatatagtttcaaagcataggtgccagctgggagaatgt
cctgtttgggatgtgaagaaacaagtaatttgttggatagatatccttaggggagaaatc
catcaatatagcccagtagatagcacacatgtcaaactggctgtacctccattgaccgga
tcaatggcgctttgtaaagatggaaattttatagcggcgctaagaagtggaataagtttt
atcgacaggaaaaccgctgagataaaattcatttcaaatccggaaactcacttacctttt
aatcggtttaatgaggggaaatgtgacccagaaggaaggttttgggttggaaccatgtcg
cttacagatgaggagaaaaaaggcagcgtgtatgcactggacgaaaaattaaagatagat
aaaaaaatcacagaggtttctatatccaacggtctggcttggagcggtgataaaaagaca
ttgtactacattgatacgcctactttcgaaatcgtttcttatgattatgatagcagtaca
ggcactataacgaataggaaagtggtgatcaaagtttcggaaaaagatggataccctgat
ggaatgaccattgacaatgaaggtatgctttgggtagcgcattgggatggatggcaaata
acacgttgggatcctataaatggtgaaaaattgttgagcattcctatgccggttgccaga
gtaacttcatgcacctttggtggtaaaaatctaaatgatttatatgttacttcagcaaga
accgggctcagcacatctgatttaaaaaaacaacccgaggctggggccatttttgtaatc
aggaatagttctttcaaaggcttacctgctattgaatttaactattaa

DBGET integrated database retrieval system