KEGG   Pedobacter heparinus: Phep_3018Help
Entry
Phep_3018         CDS       T00978                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
phe  Pedobacter heparinus
Pathway
phe00020  Citrate cycle (TCA cycle)
phe00640  Propanoate metabolism
phe00660  C5-Branched dibasic acid metabolism
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01120  Microbial metabolism in diverse environments
phe01130  Biosynthesis of antibiotics
phe01200  Carbon metabolism
Module
phe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phep_3018
   00640 Propanoate metabolism
    Phep_3018
   00660 C5-Branched dibasic acid metabolism
    Phep_3018
Enzymes [BR:phe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Phep_3018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACU05216
UniProt: C6Y2K6
Position
3608571..3609761
Genome map
AA seq 396 aa AA seqDB search
MNIHEYQGKEILKSFGVAVQEGIVADTVEQAVEAAKKMKTDYNSDWVVIKAQIHAGGRGK
GGGVKLAKNLDEVKERATAILGMQLVTPQTGPEGKKVNKILVAQDVYYPGASETKEFYIS
VLLNRGNGRNIIMYSTEGGMDIEEVAEHTPHLIFKEEIDPKVGLQAFQARKIAFNLGLSG
AAFKEMVKFVTALYKAYDSTDSAMFEINPVLKTSDDKIIAVDAKVDLDENALFRHPDYAA
MRDKLEEDPTDVEASESNLNYVKLDGNVGCMVNGAGLAMATMDIIKIAGGEPANFLDVGG
TANAQTVKAGFNIILKDPNVKAILINIFGGIVRCDRVAQGVIDAYNEIGNVPVPIICRLQ
GTNAEEAKKLIDESGLKVYSAIALKEASDLVTKVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaatatcaaggtaaagaaatacttaaaagttttggtgtagccgtacaa
gaaggtatagttgccgacacggtagagcaggctgtagaagctgctaaaaaaatgaaaact
gactacaattctgactgggttgtaattaaagctcagatccacgcaggtggacggggtaaa
ggcggtggtgtaaaactagccaagaaccttgatgaggttaaggaaagagcaactgcaatt
ttaggaatgcagcttgtaactccgcaaactggtcctgaaggaaaaaaagttaacaagatt
ttagttgcccaggatgtatattatccgggagcttctgaaaccaaagagttctatataagc
gttttattgaaccgtggaaatggaagaaacatcatcatgtattcgactgaaggtggtatg
gacattgaagaagttgcggagcatacccctcatctgatctttaaagaagaaattgaccct
aaagttggcttacaagcatttcaggcacgcaaaattgcttttaatttaggtttaagcggt
gcggcttttaaagaaatggtaaaatttgtaactgcactttacaaagcttatgacagcacg
gattctgcgatgttcgaaatcaatccagtgttaaaaacttctgatgacaagatcatcgct
gttgatgctaaagttgatctggatgagaatgcattgttccgtcatcctgattatgcagca
atgcgcgataaactggaagaagatcctacagatgtggaagcaagtgaatctaaccttaat
tatgtaaagcttgacgggaacgtgggttgtatggttaatggtgccggtttagctatggct
actatggacatcattaagattgccggtggcgaacctgctaacttccttgatgttggtggt
actgcaaatgcacaaactgtaaaggctggttttaacattatacttaaagaccccaacgta
aaagcaatcctgatcaatatatttggtggtattgtacgttgtgaccgggttgcacaagga
gtaatagatgcatataatgaaattggtaatgttccggttcctatcatttgccgtttacaa
ggtaccaatgctgaagaggcgaaaaaactgatagatgaatcaggattgaaagtttattca
gctattgctttaaaagaagcatctgacctggtaactaaagttttagcttag

DBGET integrated database retrieval system