KEGG   Pedobacter heparinus: Phep_3328Help
Entry
Phep_3328         CDS       T00978                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
phe  Pedobacter heparinus
Pathway
phe00471  D-Glutamine and D-glutamate metabolism
phe00550  Peptidoglycan biosynthesis
phe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Phep_3328
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Phep_3328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phe01011]
    Phep_3328
Enzymes [BR:phe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Phep_3328
Peptidoglycan biosynthesis and degradation proteins [BR:phe01011]
 Precursor biosynthesis
  Amino acid ligase
   Phep_3328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 3HCDH_N AlaDh_PNT_C Pyr_redox_2 PgdA_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACU05522
UniProt: C6Y479
Position
complement(3948273..3949616)
Genome map
AA seq 447 aa AA seqDB search
MEKKRIAILGAGESGVGAAMLAQKHGYDVFVSDFGTIPSQYKEKLEALNIVFEENTHTAA
EILKAVEVIKSPGIPDTAGIIKEIRSRNIPVLSEIEFAKRYTKAKTICITGSNGKTTTTM
LTYHILKNAGLNVGLAGNIGHSFAAQVASADFDWYVLEISSFMLDDMYDFKADIAVLLNI
TPDHLDRYDYKLGNYAASKMRITQNQTSEDIFIYCADDEETLKALKNVKVDSKTYPFSIR
KKIEKGAYLESNNIHININLNDQLTMSITELALQGKHNIYNSMASGIVAKVLDIRNTAIR
ESMGDFKNIEHRLEHVARISGVDYINDSKATNVNSTWYALESVGTDVILIMGGVDKGNDY
DMLKDMVRQKVKAIVCLGKDNKRIHEAFEDDVEIIVNTFSAHEAVQVAYHLAKKGNTVLL
SPACASFDLFKNYEDRGNQFKAAVKEL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaggatagcaattctgggagcgggagaaagcggggtaggtgcagcaatg
ctggcacagaagcatggttatgatgtattcgtgtcagattttggtacaattccttcacaa
tacaaggaaaagcttgaggcacttaacattgtatttgaagaaaacacgcatacggcagcc
gagatcctgaaagcggttgaagtgattaaaagtcccggtatacctgatacagccggtatc
attaaagagataagatcccggaatattccggtgctttctgaaattgaatttgcaaaacgg
tatacgaaagcaaaaactatatgcattacggggtctaatggtaagaccactactaccatg
ttaacttaccatattctgaaaaatgcaggtttaaacgtagggcttgcagggaatatcggg
catagctttgccgcgcaggtggctagtgctgattttgactggtatgtactggagatatct
agctttatgctggatgatatgtatgatttcaaagcggatattgctgtgctgttaaacata
acacccgatcatttagacaggtacgactataaattgggtaattatgctgcatcaaaaatg
cgcattacgcaaaatcagaccagtgaagatatttttatttactgtgctgatgacgaagaa
actttaaaagcgttgaaaaatgttaaggtggattcaaaaacatatcctttttccatccgg
aaaaaaatcgaaaagggagcctatctggaaagcaacaacatacacatcaatataaaccta
aacgatcaattaaccatgtctattacagaattagccctgcagggaaagcacaatatttat
aactctatggcatcgggcatagtagctaaggtattagatatcagaaataccgctatacgc
gagagtatgggggattttaaaaatattgaacacaggctggagcatgttgcgaggatttcc
ggtgttgattatatcaacgattcaaaggcaacaaacgtaaattctacctggtatgcgctg
gaaagtgtagggactgatgtgatcctgattatgggtggggtagataaaggaaacgattat
gatatgttgaaggatatggtccgtcagaaggttaaggcaattgtatgtttaggtaaagac
aataagcggatccatgaggcttttgaagatgatgtagaaattattgtaaacacgttttct
gctcatgaggcagttcaggtggcctatcatctggccaaaaaaggaaatacagtgctgttg
tcacctgcttgtgcaagttttgacctgtttaagaattatgaggacaggggcaaccagttt
aaggcggcagttaaagaattatag

DBGET integrated database retrieval system