KEGG   Pedobacter heparinus: Phep_4197Help
Entry
Phep_4197         CDS       T00978                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
phe  Pedobacter heparinus
Pathway
phe00230  Purine metabolism
phe01100  Metabolic pathways
Module
phe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Phep_4197
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Phep_4197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 RNA_helicase cobW AAA_16 AAA ABC_tran TsaE RsgA_GTPase Thymidylate_kin ResIII MobB AAA_17 Rad17 CbiA
Motif
Other DBs
NCBI-ProteinID: ACU06388
UniProt: C6XX82
Position
5075550..5076119
Genome map
AA seq 189 aa AA seqDB search
MKQGKLIIFSAPSGAGKTTIVKHLLTKFPSLSFSISATTRELRGDEKNEKDYYFITKEDF
LHKVARQEFVEFEEVYSGTFYGTLRSEIQRIWDEDKHVIFDIDVEGGLRLKRKYENDALA
IFVQPPSLAVLKERLRGRGTDSPEKLQERFVKAEKELAYADKFDVILNNFDLHTACLEAE
KLVGDFIKK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggtaaactgattatattttctgctccctcgggtgcaggcaaaaccaccatc
gttaaacatttgcttacgaaattcccttcattgagcttttctatatcagcaactacccgg
gagttgcgcggggatgagaaaaatgaaaaagactattattttattaccaaagaagatttt
ctgcacaaagttgcgcgccaggaatttgtagagtttgaagaagtttacagcggaactttt
tacggcaccctgaggtctgaaatccagcgcatctgggatgaagacaaacatgtcattttt
gatattgatgtagaaggtggcttgcgcttaaaacgtaaatatgaaaatgatgcgctagct
atatttgtacaacccccatccttagccgtacttaaagaacgtttaaggggcaggggtacc
gatagccccgaaaagctgcaggagcgctttgttaaagcagagaaagaactggcttatgcc
gataaatttgacgttatccttaacaactttgacctgcatacagcctgtctggaagcagaa
aaactggtaggggattttataaaaaaataa

DBGET integrated database retrieval system