KEGG   Providencia heimbachae: NCTC12003_02652Help
Entry
NCTC12003_02652   CDS       T05509                                 

Gene name
agp
Definition
(GenBank) Glucose-1-phosphatase precursor
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
phei  Providencia heimbachae
Pathway
phei00010  Glycolysis / Gluconeogenesis
phei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCTC12003_02652 (agp)
Enzymes [BR:phei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     NCTC12003_02652 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 EF-hand_1
Motif
Other DBs
NCBI-ProteinID: SQH13913
Position
1:complement(2904081..2905334)
Genome map
AA seq 417 aa AA seqDB search
MKYRMLTLCLSAALFTPMSPVLASTDNTQDMVLDQVLVLSRHNLRTPIVNTGVLTEITDK
KWPEWDAQSGYLTTKGGALEVYMGHYFREWIDQNKLLADELCPTSRDDIYIYTNSLQRTI
ATGQFFAAGAFPGCKVNIHHQPEIGTMDPVFNPIITNNTPEFKKKAISAMDQHLKGVDLK
PGYDELDSILNIKDSQKCKTDKLCNLAVAKNSFIVEADKEPGVSGPLKMANSAADAIDLQ
YYEGFPLNDVAWGLVNSPEKWKKLNTLKNGYQNTLFGPKIIAKNVAHPILNYINNGFASV
DKGETAKFIFLVGHDSNIASLMSAMNFNPYQLPQQYEHTPIGGKLVFQRWHDKQDNKDYM
KVEYVYQTSDQLRDSTYLSLKTPPKHVTLELKDCSIDKNGYCSWDDFQKVMKAALQQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatagaatgctcacactgtgcttatctgctgcgttattcacaccaatgtcccca
gtattggcaagtacagataatacgcaagatatggttttagaccaagttctcgtacttagc
cgtcataacctgcgtaccccgattgttaacacaggcgtcttaacggaaatcacggataaa
aaatggcctgaatgggatgctcaaagtggctatttaaccacgaaaggtggtgctcttgaa
gtttatatggggcattattttagggaatggattgatcaaaataaattattagcagatgaa
ttatgcccaacaagccgtgatgatatttatatatataccaatagtttgcaaagaacgata
gcaacggggcaattttttgccgccggtgcatttcctggctgtaaggtgaatattcatcat
caacctgaaattggaacgatggatccagtatttaatccaattatcacaaataatacgccg
gagtttaagaaaaaagcgatatccgcgatggatcaacaccttaagggggtagatcttaag
ccgggttatgatgagttagacagtattcttaatattaaagattctcaaaaatgtaaaaca
gataaactgtgtaatttagcggtagcaaaaaatagttttattgttgaagccgataaagaa
ccgggtgtaagtggcccattgaaaatggcgaactctgcggcagatgcgattgatcttcaa
tattatgaaggctttccattaaatgatgttgcttggggattagttaattcgccagaaaag
tggaagaagcttaatacactaaaaaatggttatcaaaacacgttatttggtcctaaaata
atcgcaaaaaatgtcgctcatcctatcttgaattatattaataatggttttgcttctgtt
gataaaggtgaaacagctaaatttatatttttagtggggcatgactctaatattgcttcc
ttgatgtcagcaatgaattttaatccatatcaattgccccaacaatatgagcatacacca
attggcggtaagttagttttccaacgctggcatgataagcaggataacaaagattacatg
aaggtagagtatgtttatcaaacctcagaccaattacgagatagcacttatctatcttta
aagacgccgccaaaacatgtcactttagagctaaaggattgttctatcgataaaaatggt
tattgttcttgggatgatttccaaaaagtgatgaaagccgcattacagcagtaa

DBGET integrated database retrieval system