KEGG   Providencia heimbachae: NCTC12003_03064Help
Entry
NCTC12003_03064   CDS       T05509                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
phei  Providencia heimbachae
Brite
KEGG Orthology (KO) [BR:phei00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phei03016]
    NCTC12003_03064 (truC)
Enzymes [BR:phei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     NCTC12003_03064 (truC)
Transfer RNA biogenesis [BR:phei03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    NCTC12003_03064 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: SQH14380
Position
1:complement(3345415..3346173)
Genome map
AA seq 252 aa AA seqDB search
MLEIIYHDEHIIAINKPAGMLVHRSWLDSKETVFVMQTLRDQIGQYVFPVHRLDRPTSGV
LLFALSSEVARLLSEQFEHHHIEKKYHAIVRGYVTEAQTIDYPLLEELDKIADKRATREP
VLQECVTHCEPIAVVECPVAIGRYETARFSLLELKPETGRKHQLRRHMSHIRHPIIGDSK
HGDLRQNRGVTEHFAVSRLMLHASELILSHPITKEKISLVASWDAQWLSLIEQFEWLDLA
TELGVNVIKQPT
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaattatttatcatgatgagcatataattgcgattaataagcccgcgggaatg
ttagtgcatcgtagttggttagatagtaaagaaacggtatttgtgatgcaaaccttacgc
gaccaaattggtcagtatgtgttccccgttcatcgtttggatagaccaacgtcaggtgtt
ctcctttttgccctttcgagtgaagttgctagattactttccgaacaatttgagcatcat
catattgaaaaaaaatatcatgcgatagtgcgaggttatgtaactgaagcacaaacaatt
gattatccattacttgaagagctggataaaattgcagataaacgcgcgacaagagaaccc
gtattacaagagtgcgtaacgcattgtgagccaattgcggttgttgaatgtccggtggca
atcgggcgttatgaaaccgctcgttttagtctccttgagctaaaacccgaaacaggtcga
aagcaccagttaaggcgtcatatgtctcatattcgacatcccattattggggatagtaag
catggggatttgcgccaaaataggggtgttaccgaacattttgccgtgtctcgattaatg
cttcatgcgagcgagttaattttaagtcacccaataacaaaagagaaaatatcccttgtt
gcttcttgggatgcacaatggctatcacttattgaacagtttgaatggttagatttggct
actgagttaggtgttaacgtcattaaacaacctacttaa

DBGET integrated database retrieval system