KEGG   Pseudonocardia sp. HH130630-07: AFB00_19815Help
Entry
AFB00_19815       CDS       T04486                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00620  Pyruvate metabolism
phh00630  Glyoxylate and dicarboxylate metabolism
phh01100  Metabolic pathways
phh01110  Biosynthesis of secondary metabolites
phh01120  Microbial metabolism in diverse environments
phh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:phh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFB00_19815
   00630 Glyoxylate and dicarboxylate metabolism
    AFB00_19815
Enzymes [BR:phh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AFB00_19815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ANY08157
UniProt: A0A1B1ZQX2
Position
4183408..4185546
Genome map
AA seq 712 aa AA seqDB search
MAERSGLQVDEHLGSFVEDELLADVKLTAADFWATLANLQERFAPRIAGALARRDEIQAA
IDAWHAEHGAGTVEEYERFLTDLGYLEPEASPAISVDRVDPEIAEIAGAQLVVPSTVPRY
ALNAANARWGSLFDALYGTDALPQDSELAPGYDERRGAQVITAADELLDELFPLAQGSHA
DAGGYRAGTDGLVTDGGTGLADPAQFAGFRPLDADGRGALLLTRNGLHLELTIDPTTQVG
RQHHAGVADVVLESAVSTIVDLEDSVATVDGEDKSTAYRTWLGLLTGDLTSEFSKGGKTV
VRRVNPDREYTAPDGSALTLPGRSLMLIRNCGHHMTTNAVRTADGAEIAEGVLDALVSAV
AGLYDLQHKGPHTNSRVGSVYIVKPKQHGPAEVALTVELFGAIEEALGMAPNTLKIGIMD
EEKRTTVNLSACIAEAANRVIFVNTGFLDRTGDEIHTCFRAGPVLPKGDMKSTTWLKTYE
DRNVDVALAAGFSHAAQVGKGMWAKPAAMAEMIEQKIGHPKAGANCAWVPSPTAATLHAL
HYLRVDVHDVQSRLASRGTADRRRLLELPLAAPSALAADAVTHELETNAQSILGYVVRWV
GMGIGCSTVPDLDGVGLMEDRATLRISAQLVANWLAHGIVDEQVVRDTFARMAAVVDEQN
AGESGYPAMAPDLDGSESFQAALELVFTGAEEPNGYTERTLTRWRQRAKANA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgctccgggctgcaggtcgacgagcacctgggctcgttcgtcgaggacgag
ctcctggccgacgtgaagctcaccgcggccgacttctgggcgacgctggcgaacctgcag
gagcggttcgcgccccggatcgccggggcactggcccgccgggacgagatccaggccgcg
atcgacgcctggcacgccgagcacggcgccggcacggtcgaggagtacgagcggttcctg
accgacctcggctacctggagccggaggcgtccccggcgatctccgtcgaccgggtcgac
ccggagatcgccgagatcgcgggtgcgcagctcgttgtgccctccacggtgccgcggtac
gcgctgaacgcggcgaacgcccgctggggctcgctgttcgacgccctctacggcaccgac
gcgctgccccaggactccgagctcgcccccggttacgacgagcggcgcggcgcccaggtc
atcaccgccgccgacgagctgctcgacgagctgttcccgctggcacagggcagccacgcc
gacgccggtggctaccgggccggtaccgacggcctggtgaccgacggcggcaccggcctc
gccgatcccgcgcagttcgccgggttccgcccgctcgacgccgacggccgcggcgccctc
ctgctgacccgcaacgggctgcacctggagctgacgatcgacccgaccacccaggtcggg
cgccagcaccacgcgggggtcgccgacgtcgtgctggagtcggcggtgtccaccatcgtc
gacctggaggactcggtcgccacggtcgacggcgaggacaagtccaccgcctaccgcacc
tggctcggcctgcttaccggcgacctgaccagcgagttcagcaagggcggtaagacggtc
gtccggcgggtgaatccggaccgcgagtacaccgcgccggacgggtccgcgctgacgctg
ccgggccgctcgctgatgctgatccgcaactgcggtcaccacatgacgacgaacgcggtg
cgcaccgcggacggtgcggagatcgccgagggcgtgctcgacgcgctcgtctccgccgtc
gccgggctctacgacctgcagcacaagggcccgcacaccaactcccgggtgggcagcgtc
tacatcgtcaagcccaagcagcacggcccggccgaggtcgcgctcaccgtcgagctgttc
ggcgcgatcgaggaggcgctcggcatggcgccgaacacgctcaagatcgggatcatggac
gaggagaagcggaccaccgtcaacctctcggcctgcatcgccgaggcggcgaaccgggtg
atcttcgtgaacaccggtttcctcgaccggaccggcgacgagatccacacctgcttccgg
gccgggccggtgctgcccaagggcgacatgaagtccacgacctggctgaagacctacgag
gaccgcaacgtcgacgtcgcgctcgccgccgggttcagccacgccgcccaggtgggcaag
ggcatgtgggccaagccggccgcgatggcggagatgatcgagcagaagatcggtcacccg
aaggccggcgccaactgcgcctgggtgccctcgccgaccgcggcgaccctgcacgcgctg
cactacctgcgggtcgacgtgcacgacgtgcagtcccggctcgcgtcgcgcggcaccgcc
gaccggcgccggctcctggagctgccgctcgccgccccgtcggccctcgcggcggacgcc
gtcacccacgagctggagacgaacgcgcagtcgatcctcggctacgtcgtgcgctgggtc
ggcatgggcatcggctgctcgaccgtccccgacctcgacggggtcgggctgatggaggac
cgcgcgacgctgcggatctccgcccagctcgtcgccaactggctggcgcacgggatcgtc
gacgagcaggtcgtgcgggacaccttcgcccggatggccgcggtcgtggacgagcagaac
gccggtgagtccggctacccggcgatggctcccgacctcgacggcagcgagtcgttccag
gcggcgctggagctggtgttcaccggcgccgaggagccgaacggctacaccgagcgcacg
ctgacccgctggcggcagcgggcgaaggcgaacgcctga

DBGET integrated database retrieval system