KEGG   Pseudonocardia sp. HH130630-07: AFB00_25375Help
Entry
AFB00_25375       CDS       T04486                                 

Definition
(GenBank) dihydroxyacetone kinase
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00561  Glycerolipid metabolism
phh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AFB00_25375
Enzymes [BR:phh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     AFB00_25375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1
Motif
Other DBs
NCBI-ProteinID: ANY10382
UniProt: A0A1B1ZXC9
Position
complement(5339823..5340839)
Genome map
AA seq 338 aa AA seqDB search
MSLPFHPRTGDPVPPALRGFAHAHADLVEPVESPAHLLARHRSPQRRVGIVSGGGSGHEP
LHAGFLGRGMLDAAAPGKVFASPHNVQVLAASRAVAGPEGVLHVVKNYTGDRINFGIAAE
RLRMEGIEVRRVLVDDDLATDSADTATGRRGTGATVVVEKILGGAADAGLGLEELARLGT
DVAGASRSLAVASRAQTSMHTGRPAFELGDGELEYGVGIHGERAQRSIDRPGTEELVDRM
LDELVAALPGTGGEVITVVNGLGGTTQMELYGLHELLTAGLDRHGLGVAGQLVGTLVPAL
DMTGFSLTLTRADPGWIPWWDAPAHTPAFSTVPQEAFR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccttccatccgcgcaccggggacccggtaccaccggcgctgcgcgggttc
gcccacgcgcacgccgatctcgtcgaacccgtcgagtcaccggcccatctgctcgcgcgg
caccggagcccgcagcgccgggtcgggatcgtctccggcggcggctccgggcacgaaccg
ctgcacgccggtttcctggggcgcgggatgctcgacgccgcggcgccgggcaaggtgttc
gcctcgccgcacaacgtgcaggtgctcgccgcctcacgcgcggtggccggcccggagggt
gtgctgcacgtcgtcaagaactacaccggtgaccggatcaacttcgggatcgccgcggag
cggctgcggatggagggcatcgaggtccgacgggtgctcgtcgacgacgacctcgcgacc
gactcggccgacaccgcgaccggacggcgcggcaccggtgccacggtcgtcgtggagaag
atcctcggcggcgcggcggacgccgggctcgggctggaggagctggcccggctcggcacc
gacgtcgccggggcctcccggagcctggccgtcgcctcccgggcgcagacgtcgatgcac
accggccggccggcgttcgagctcggcgacggcgagctggagtacggcgtgggcatccac
ggcgagcgggcgcagcggtcgatcgaccggccgggcaccgaggagctcgtcgaccggatg
ctcgacgagctcgtcgccgcgctccccggcaccggcggcgaggtgatcaccgtcgtcaac
gggctcggcggtaccacccagatggagctctacggcctgcacgagctgctcaccgccggg
ctcgaccggcacggcctcggtgtcgccgggcagctcgtcgggaccctggtgccggcgctg
gacatgaccggcttctcgctcaccctgacccgtgccgatcccggatggatcccctggtgg
gacgccccggcccacacacccgcgttctcgaccgtcccgcaggaggcgttccggtga

DBGET integrated database retrieval system