KEGG   Pseudonocardia sp. HH130630-07: AFB00_28500Help
Entry
AFB00_28500       CDS       T04486                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:phh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFB00_28500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phh01007]
    AFB00_28500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phh03016]
    AFB00_28500
   03029 Mitochondrial biogenesis [BR:phh03029]
    AFB00_28500
Enzymes [BR:phh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     AFB00_28500
Amino acid related enzymes [BR:phh01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   AFB00_28500
Transfer RNA biogenesis [BR:phh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AFB00_28500
 Prokaryotic Type
   Other AARSs
    AFB00_28500
Mitochondrial biogenesis [BR:phh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AFB00_28500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ANY10483
UniProt: A0A1B1ZXI9
Position
complement(6023496..6025340)
Genome map
AA seq 614 aa AA seqDB search
MMRTHPVGTLRAEHTGQTVTLAGWVARRRDHGGVIFIDLRDRSGSAQVVFREGEMAERAH
RLRSEFCVQVVGEIVRRPAGNENAELPTGDIEVTVTELTVLSEAAPLPFPIDDHTGVGEE
IRLTHRYLDLRRSGPAAAMKLRSDVSKAARDVLATEDFIEVETPTLTRSTPEGARDFLVP
ARLRPGSWYALPQSPQLFKQLLMVGGLERYYQIARCYRDEDFRADRQPEFTQLDIEMSFV
EQDDVIALAEKVLVALWKLVGYDVPLPIPRMSYAEAMAQYGSDKPDLRFGFELTELTDYF
AGTGFRVFQNPYVGAVVMPGGASQPRKVLDGWQEWAKQRGARGLAYVLIGDDGQVDERGP
VVKNLSETERAGLAAAVGANPGDCIFFAAGKPNDARALLGAARGEIARRTGAIDESAWSF
LWIVDAPLFESAADTDDVAVGGGAWTALHHAFTSPTPEWIDTFEKSPGDALAYAYDIVCN
GNEIGGGSIRIHSADVQKRVFEVMGLSEAEAQEKFGFLLDAFAYGPPPHGGIAFGWDRIT
ALLAGVDSIREVIAFPKTGGGFDPLTQAPAPITAGQRKEAGVDAKPAGTAPGGAAPGKPG
ETGGGAPEKPGPAA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgaacccaccccgtcggcacgttgcgtgccgagcacaccggccagaccgtgacc
ctcgccggatgggtggcccgccgccgcgatcacggcggcgtgatcttcatcgacctgcgg
gaccgttccggttcggcccaggtcgtgttccgcgagggcgagatggccgagcgcgcccac
cggctccggtcggagttctgcgtgcaggtcgtcggtgagatcgtccggcgccccgcgggc
aacgagaacgccgagctgcccaccggcgacatcgaggtcaccgtcaccgagctgaccgtg
ctgtcggaggcggccccgctgccgttcccgatcgacgaccacaccggcgtcggcgaggag
atccggctgacgcaccgctacctggacctgcgccggtccggcccggccgcggcgatgaag
ctccgcagcgacgtgagcaaggcggcccgcgacgtgctcgccaccgaggacttcatcgag
gtcgagaccccgacgctgacccgctcgacgcccgagggggcccgggacttcctggtcccg
gcccggctgcgccccggctcctggtacgcgctgccgcagagcccgcagctgttcaagcag
ctgctcatggtcggcggcctggagcggtactaccagatcgcccgctgctaccgcgacgag
gacttccgcgccgaccggcagccggagttcacccagctcgacatcgagatgagcttcgtc
gagcaggacgacgtcatcgcgctggcagagaaggtgctcgtcgcgctgtggaagctggtc
ggctacgacgtgccgctcccgatcccgcggatgagctacgccgaggcgatggcgcagtac
gggtcggacaagcccgacctgcgtttcggcttcgagctgaccgagctgaccgactacttc
gcgggcaccgggttccgggtcttccagaacccctacgtcggcgccgtcgtcatgccgggc
ggcgcgtcccagccgcgcaaggtgctcgacggctggcaggagtgggccaagcagcgcggc
gcccgcggcctggcctacgtcctgatcggcgatgacgggcaggtcgacgagcgcggcccg
gtcgtcaagaacctctccgagaccgagcgtgccgggctggccgccgcggtcggcgcgaac
cccggcgactgcatcttcttcgccgcgggcaagccgaacgacgcgcgtgcgctgctcggc
gccgcgcgcggggagatcgcccgccggaccggtgcgatcgacgagtccgcgtggtcgttc
ctctggatcgtcgacgccccgctgttcgagtccgccgccgacaccgacgacgtcgccgtc
ggcgggggtgcctggaccgcgctgcaccacgccttcacctcgccgaccccggagtggatc
gacaccttcgagaagagcccgggcgacgcgctggcctacgcctacgacatcgtctgcaac
ggcaacgagatcggcggcggatcgatccgtatccactcggccgacgtgcagaagcgcgtc
ttcgaggtcatggggctgtccgaggccgaggcgcaggagaagttcggcttcctgctcgac
gccttcgcctacggcccgccgccgcacggcgggatcgccttcggctgggaccggatcacc
gcgctgctcgcgggggtcgactcgatccgcgaggtcatcgcgttcccgaagaccggtggc
gggttcgacccgctgacccaggcccccgcgccgatcaccgcaggccagcgcaaggaggcc
ggtgtggacgcgaagccggccggtaccgcgcccggtggggccgctcccgggaagccgggg
gagaccggtggcggggcgccggagaagcccggtccggcggcgtag

DBGET integrated database retrieval system