KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099795Help
Entry
102099795         CDS       T02921                                 

Gene name
QDPR
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00790  Folate biosynthesis
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102099795 (QDPR)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     102099795 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase Kelch_5
Motif
Other DBs
NCBI-GeneID: 102099795
NCBI-ProteinID: XP_005517875
Position
Un
AA seq 327 aa AA seqDB search
MTGLESSELQQGAQSPSQPAYSSRSPGDSNTAPGVARPGHWHSPLSSARPGRAARPGPAP
RPTHGRARPLTRPVGRPIRAGHSSAGAAAMAAGRVLVYGGRGALGSQCVRYFKSKNWWVA
SIDLAENADASANVVVTATDSFPEQAEQVTAEVGKLLGEEKVDAILCVAGGWAGGSAKAK
SLYKNCDLMWKQSVWTSTISSHLATKHLKEGGLLTLTGAQAALSGTPGMIAYGMAKGAVH
QLCQSLAGASSGLPSGSAAVAILPVTLDTPANRKSMPDADFSSWTPLEFIAETFYDWITA
KNRPSSGSLIQVITTGGKTELVSAAHL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtctggaatcttctgaactacaacagggcgcacaaagcccctcgcagcctgct
tacagcagcagaagccctggggatagtaacacggcccctggcgtggctcggccgggacac
tggcactcccccctctcctccgcacggcccgggcgggcagcccggccgggcccagcccct
cgccccacccacggccgggcccggcccctcacccgccccgtggggcggcccatccgcgcc
gggcacagcagcgccggtgcggcggccatggcggcgggcagggtgctggtgtacgggggc
agaggggcgctgggctcccagtgcgtgcggtacttcaagtccaagaactggtgggtggcc
agcatcgatctggcggagaacgcggacgccagcgccaacgtggtggtgacagcgaccgac
tccttccccgagcaggccgagcaggtgacagcagaagttggaaaacttcttggtgaagaa
aaggtggatgcgatcttgtgtgtagcaggaggatgggctggaggcagcgccaaagccaag
tctttatacaaaaactgtgatctgatgtggaagcagagcgtttggacatcgacaatttcc
agccaccttgccacgaaacatctgaaagaaggtggcctcttgactctgacaggagctcaa
gctgctttatctggaaccccagggatgattgcctatggcatggccaaaggggcagtgcat
cagctttgtcagagtttggctggtgccagcagtgggctgccatctggttctgctgcagtt
gccattttaccggttaccttggatacacctgcaaacaggaaatcaatgcctgatgcagat
ttcagctcctggacacccttagaattcattgcagaaaccttttatgactggataacagca
aagaatcgaccaagctctggcagtctaatccaggtgataactacaggtgggaagactgaa
ctagtttcagcagcacatctttga

DBGET integrated database retrieval system