KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100159Help
Entry
102100159         CDS       T02921                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102100159
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:phi03012]
    102100159
Translation factors [BR:phi03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102100159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N TetR_C_22 Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 102100159
NCBI-ProteinID: XP_005534643
Position
Un
AA seq 434 aa AA seqDB search
MGVSVGQEKPKMFAKGTEITVGLVVKKLNEILQARGKKGTDRWGCPIDPPELWQKCLGCI
EELLELLFAHPEIFVGENVLEESENLSNPEQDVRVRGCTCGPQVSPGAPRCAQVTAGAVA
EYVEHLKDEGRVCAIIARLQRYLQGKGSPEELCRVYLRRVLHTYYKFDYGAARRKGGAGQ
VKEEGQEKEEEEEEEDSEALMERLCRFVYAKDRTDRIRTCAILCHIYHHALHSRWYRARD
LMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLIKDAHNALLDIQSSGRAKELLG
QGLLLRSLQERNAEQEKVEKRRQVPFHMHVNLELLECVYLVAAMLLEIPYMAAHEFDARR
RMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKTGDWRRCHRFVVNDKMNGKVWD
LFPEAEQVRAMLVR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggggtctctgtggggcaggagaagcccaagatgttcgccaagggcaccgagatcacc
gtggggctcgtggtgaagaaactcaacgagatcctgcaggcccgcggcaagaagggcacg
gacaggtggggctgccccatagatcctccggagctgtggcagaagtgcctgggctgcatc
gaggagctgctggagctgcttttcgcccaccccgaaattttcgtcggcgaaaacgtcctg
gaggagtcggagaacctgagcaaccccgagcaggacgtacgggtccgagggtgcacttgt
ggcccccaggtgtccccaggagcccccaggtgtgcccaggtgaccgcaggtgccgttgca
gagtacgtggagcacctgaaggacgagggccgggtgtgcgccatcatcgcgcggctgcag
cgttacctgcagggcaagggcagccccgaggagctgtgccgcgtttacctgcgccgcgtc
ctccacacctactacaagttcgactacggcgccgcccgcaggaagggcggggccggccag
gtgaaggaggaggggcaggagaaggaggaggaggaagaggaggaggattcagaggcactg
atggagaggttgtgcaggttcgtgtacgccaaggaccgcacggaccggatccgcacctgc
gccatcctgtgccacatttaccaccacgccctgcacagccgctggtaccgcgcccgcgac
ctgatgctgatgtcacacctgcaggacaacatccagcacgccgacccacctgtgcagatc
ctctacaaccgcaccatggtgcagctgggcatctgcgccttccggcaggggctgatcaag
gacgcgcacaacgcgctgctggacatccagtcctcgggccgggccaaggagctgctgggc
caggggctgctcctgcgcagcctgcaggagcgcaacgccgagcaggagaaggtggagaag
cgccgccaggtgcccttccacatgcacgtcaacctggagctgctggagtgcgtctacctg
gtggcggccatgctgctggagatcccctacatggcggcgcacgagttcgacgcgcgccgc
aggatgatcagcaagcagttccaccaccagctgcgggtgggggagaggcagccgctgctg
gggccccccgagtcgatgcgggagcacgtggtggccgcgtccaaggcgatgaagacgggc
gactggcgccgctgccaccgcttcgtggtcaacgacaaaatgaacggcaaagtctgggac
ctgttccccgaggccgagcaggtgcgcgccatgctggtcaggtga

DBGET integrated database retrieval system