KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100879Help
Entry
102100879         CDS       T02921                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00260  Glycine, serine and threonine metabolism
phi01100  Metabolic pathways
phi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102100879
Enzymes [BR:phi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     102100879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102100879
NCBI-ProteinID: XP_005530759
Position
Un
AA seq 364 aa AA seqDB search
MRRAMARAAVGDDDYGEDPAVNELQRLAAGTLGTESALFVPTATMANLIAVMCHCQRRGA
QLFLGQDSHLHQYEHGGAAQVAGVHTQALPDLPNGTFDLDQLELTIREAHDSRYHPRPEL
ICLENTHSSAGGRALPLTYLRQVRGLADRYGLRVHMDGARLMNAAVAQGVQPAQIAQHCD
SVSLCFSKGLGAPAGAVLAGCREFVTEAWRVRKLLGGGMRQAGVLAAAARLGLQRAEATL
GRDHTNARRFAEGIHVLDSPLLSINLAAVETNIVMVNVQGAWPSPAELCHRLRAVSEEEV
AETGQAVSVLLLPWSARTARAVWHRDISDRDTELARRKLEFVARKCQEELALGLHPMSPG
TGGA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccatggcccgcgccgccgtgggcgacgacgactacggggaggacccggca
gtgaacgagctgcagcgcttggctgcggggactctgggaacggaatcggctctgttcgtg
cccacggccaccatggcaaatctcatcgccgtgatgtgccactgccagcgcaggggggct
cagctgttcctgggccaggacagccacctgcaccaatacgagcacggcggggccgcgcag
gtcgctggtgtgcacacccaggcactgccagatctgccgaatggcacatttgacctggac
cagctggagctgaccatccgtgaggcccacgacagccggtaccacccgcgccctgagctc
atctgcctggagaacacacacagctcggcggggggccgggcactgcccctcacctatctc
aggcaggtccgtgggctcgctgaccgttacgggctgcgggtgcacatggacggtgcacga
ctgatgaatgcagcagtggcccagggtgtgcagccagctcagattgcccagcactgtgac
tctgtgtccctctgcttctccaagggcctgggtgccccggctggcgcggtgttggcaggg
tgcagggagtttgtcaccgaggcctggcgtgtgcggaagctgctgggcgggggcatgcgg
caggcgggagtgctggcggctgctgcccgcctcgggctgcagcgcgcggaggcgacactt
ggcagagaccacaccaacgcccggcgctttgcagaaggtatccatgtgctggactctccc
ctcttgtccattaacctggcagcggtggagaccaacatcgtgatggtaaatgtccagggg
gcctggccatcccccgctgagctctgccaccgcctgcgtgccgtcagcgaggaggaggtg
gctgagactgggcaggctgtcagcgtcttgctgctcccctggtcagcacggactgcgcgc
gctgtctggcaccgcgacatctcggaccgtgacaccgagctcgcaaggagaaagctggaa
tttgtggccaggaagtgccaggaggaactggccttgggactgcatccgatgtctccaggc
actgggggagcctga

DBGET integrated database retrieval system