KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100951Help
Entry
102100951         CDS       T02921                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04270  Vascular smooth muscle contraction
phi04350  TGF-beta signaling pathway
phi04510  Focal adhesion
phi04530  Tight junction
phi04810  Regulation of actin cytoskeleton
phi05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102100951 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102100951 (ROCK1)
   04530 Tight junction
    102100951 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102100951 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102100951 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102100951 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102100951 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102100951 (ROCK1)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102100951 (ROCK1)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   102100951 (ROCK1)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102100951 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Rho_Binding Pkinase_Tyr PH Cortex-I_coil C1_1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 102100951
NCBI-ProteinID: XP_014111112
Position
Un
AA seq 1208 aa AA seqDB search
MVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKAG
HLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYE
MLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDSDISKEAKNLICAFLTDREVRLGRNGVE
EIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGN
QLPFVGFTYYSNRRYLGVPAENSNDNRMGSSVDKSVLENMQKMIYELEEQLHNEMQLKDE
MEQKCRSSNIKLDKIMKELDEEGSQRKNLETTVSQIEKDKMVLQHKINEYQRKFEQENEK
RRNVENEVSTLKDQMEDLKKISQHSQISNEKITQLQKQLEEANDLLRTESDTAARLRKGN
TEMSKSLSQVESLNRELQERCRVLESTKLQVEKDYYQLQAALESERRDRSHGSEMIGELQ
VRITTLQEEVKNIKNNLDRVEAERKQAQDMLNHSEKEKNNLEIDLNYKLKSLQDRLEQEV
NEHKVTKARLTDKHQSIEEARSVAMCEMEKKIREERAAREKAENRIVQAEKQCSMLDFDL
KQSQQKLEHLLQQKERLEDEVRNLTLKLEQETNKRIMAQNELKAQAFEADNLKGSEKQLK
QEINTLLEAKRLLEFELAQLAKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEID
ERNKETQRKMQELQNEKETLATQLDLAETKAESERLARALAEEQYYELNQESKKAASRHR
QELTDKDIIIRRLEETNNTLTKDVDLITKENTEISEKFKKQEEDYKMKKEEEINNIRMHY
EKSINTERTLKTQAVNKLAEIMNRKDFKIDRKKANMQDLRKKEKENRKLQLELNQEKEKF
NQIVVKYQKELNEMQAQLAEESTYRNELQMQLDSKESDIEQLRRKIMDLQQGMDSTSVAS
LPTDETDGNLSESRLEGWLSVPNKGNIRRHGWKKQYVVVSSKKILFYNDEKDKDQSNPSM
VLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDLEVEPVQPAEKTNFLNH
KGHEFIPTLYHFPANCEACAKPLWHVFKPPAALECRRCHVKCHRDHLDKKEELIAPCKVS
YDVTSARDMLLLASCQDEQKKWVTHLVKKIPKTPPSTFVRASPRTLSTRSSANQSFRKVV
KNTSGKTS
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggaatacatgcctggtggggaccttgtgaatttaatgagtaattacgatgtt
ccagagaaatgggcaagattttatactgctgaagttgtacttgcattagatgcaattcac
tcaatgggttttatacacagagatgtgaagcctgataatatgctgctagataaagctggt
catttaaaattagcagattttggtacttgtatgaagatgaacaaggaaggaatggtacga
tgtgacacagcggtgggaacaccagactacatctctcctgaagtattgaagtcccaggga
ggggatggttactatgggcgggaatgtgactggtggtcagttggagtcttcttgtatgag
atgcttgtaggcgatacacctttttatgcagactctttggttggaacgtacagtaagatt
atgaaccataagaactcccttactttccctgatgacagtgacatttctaaagaggcaaaa
aacctcatttgtgcctttttaactgatagggaagtgaggttaggacgaaatggtgtagaa
gaaattaaacggcaccttttcttcaaaaatgatcagtgggcttgggaaacactcagagac
acggtagcaccagttgtgcctgacttaagtagtgacattgacactagtaatttcgatgat
ctggaagaagacaaaggagaggaagaaacatttcccataccaaaagcatttgtgggcaac
cagcttccttttgtaggatttacgtactacagcaaccgtcggtatttaggtgtccctgca
gaaaattccaatgacaacagaatgggctccagtgtggacaaaagtgtgctggaaaatatg
cagaagatgatctatgagttagaagaacagctacataatgaaatgcagttgaaagatgaa
atggagcaaaagtgcagatcttcaaacataaagctagacaagataatgaaagaactggat
gaagagggcagtcagaggaagaacttagaaaccacggtgtctcagattgagaaggacaag
atggtgttacaacataaaataaatgagtaccaaagaaaatttgaacaagagaatgaaaaa
agacgcaatgtggaaaatgaagtgtccacactaaaagatcagatggaagacttgaaaaaa
attagccagcattcacaaatttcaaatgagaagataacacagttacaaaaacaactagaa
gaagcaaatgatttgctgaggacagaatctgacacagctgcaagactgagaaagggtaac
acagaaatgagcaagtcattaagtcaggtagaatcactgaacagagagctgcaagaaagg
tgcagagttctggaaagcacaaaactgcaggtggagaaggattattaccaactacaagca
gctttggagtcagaacgaagggacagaagtcatggatctgaaatgattggagaattacag
gttcggattacaactttacaagaagaagtaaaaaacattaaaaacaatcttgatcgagtg
gaagcagaaagaaaacaagcacaggatatgcttaaccattcagaaaaggaaaagaataat
ttagagatagatttgaactacaaactgaaatccttacaagaccggttagaacaggaagtc
aatgagcacaaagtgactaaagcacggttaactgacaagcaccagtcaatagaggaggca
agatcagttgcgatgtgtgaaatggaaaaaaagataagggaagaacgggcagcaagagag
aaggcagaaaatagaatagttcaagctgaaaaacagtgttccatgctggactttgacctg
aagcaatctcagcagaaactggaacatcttcttcagcaaaaggaaagactggaagatgaa
gtaaggaatctgacacttaagctagaacaagagacgaataagcgaataatggcacagaat
gaattaaaggcacaagcttttgaagctgataacttgaagggttctgagaagcagctgaaa
caggaaatcaataccttgttggaagcaaagagattactggaatttgagctggctcaactt
gcaaaacagtacagaggaaatgaaggtcagatgcgtgagcttcaggatcagcttgaagct
gagcagtatttttcgacactttacaaaactcaggttaaggaactgaaagaggaaattgat
gaaaggaataaagaaacacaaaggaaaatgcaggagttgcaaaatgaaaaagaaacactc
gctacccagttggatttagctgaaaccaaagctgagtcggaacggttggcacgggcactt
gctgaagaacagtattatgaactgaatcaggaaagcaaaaaagctgcgtcaaggcacaga
caagaattgactgataaggacatcatcataagaaggctggaagaaactaataacacttta
accaaagatgttgatttaataacaaaggaaaacacagagatcagtgaaaaatttaagaaa
caagaggaagattacaaaatgaaaaaagaggaggaaatcaataatattagaatgcattat
gagaagagcataaacactgaaagaactctgaagacacaggctgtcaacaaactggctgag
ataatgaatcggaaagattttaaaatagacagaaagaaagctaacatgcaagatttgagg
aagaaggagaaggaaaaccgaaagctccaattagaacttaatcaagaaaaagagaaattc
aatcagatagtagtgaaataccaaaaagaacttaatgaaatgcaagcgcaactagcagaa
gaatctacatacaggaatgagctccagatgcagctggatagtaaagagagtgacatagaa
caactacgaaggaaaatcatggaccttcagcaaggaatggattctaccagtgttgccagt
cttccgacagatgaaacagatggaaatctttcagaatcaagacttgaaggttggctttca
gtaccaaacaaaggaaatataaggcggcatggctggaagaaacagtatgttgtggtgagc
agtaaaaagatactgttctacaatgatgaaaaagacaaggaccagtctaatccatccatg
gtactagatatagataagctgtttcatgtccggcctgtaactcaaggagatgtatataga
gctgaaactgaagaaattcctaaaatattccagattctctatgctaatgagggggaatgc
aggaaggatttggaggtagaaccagtacagccggcagagaagacaaattttctaaatcac
aaaggccatgaatttattcccacgttataccactttccagccaactgtgaggcctgtgcc
aaacctctctggcatgtctttaaaccccctgctgccctagaatgtcgaagatgccatgtg
aagtgccacagagaccacttagataaaaaggaggaattaattgcaccatgcaaagtgagt
tatgatgtaacttcagcaagagatatgctcttgttggcatcctgtcaagatgaacagaag
aagtgggtgacgcatttagtaaagaagatccctaagacacctccatctacttttgttcgt
gcttctcctagaactttgtctacaagatcctcagcaaaccagtcattccgaaaagttgtt
aaaaatacttctggaaaaactagctaa

DBGET integrated database retrieval system