KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101314Help
Entry
102101314         CDS       T02921                                 

Gene name
PUDP, HDHD1
Definition
(RefSeq) pseudouridine 5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phi01009]
    102101314 (PUDP)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     102101314 (PUDP)
Protein phosphatases and associated proteins [BR:phi01009]
 HAD phosphatases
  Other HAD phosphatases
   102101314 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD Acid_PPase
Motif
Other DBs
NCBI-GeneID: 102101314
NCBI-ProteinID: XP_005516670
Position
Un
AA seq 235 aa AA seqDB search
MAASSSSSAAALRPVTHLIFDMDGLLLDTECLYSKVFEEICGRFGKTYSWDVKSLVLGRQ
ALEAAEFIRDTLDLPITKEELLIESKVKLEKIFHTAELMPGVSKLIHHLHKHKIPVAVAS
SSSEESFQRKITRHKDFFGLFHHIVLGDDPELKRGKPHPDPFLLCAERFHPPVPPEKCLV
FEDSPQGVKGALAAGMQVVMIPDERLNPDLKKEATLVLKSMEDFQPELFGLPAYD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttcctcctcctcctcggcggccgcgctgcgcccggtcactcacctgatcttt
gacatggacgggctgctgctggatactgaatgtctctattcaaaagtgtttgaagagatc
tgtgggcgttttggaaagacctatagctgggatgtgaaatccttggttctaggtagacaa
gccctagaagcagcagagtttattcgagatactctagaccttccaataactaaagaagag
ttattaattgaaagtaaagtgaagctggagaagatattccatactgctgagttgatgcca
ggggtcagtaagctgatccatcatttacacaaacacaagatacccgtagctgttgccagc
agctcaagcgaagagtcatttcagagaaaaataaccagacacaaagatttttttggtctt
tttcaccatattgtgttgggagatgaccctgaattgaagcgtggcaagccacatcctgat
ccatttttactctgtgcagagagatttcaccctcctgtaccaccagagaagtgtcttgtg
tttgaagattcaccacagggagtcaaaggagccctggcagcaggaatgcaagtggttatg
attccagatgaaagattaaatccagatcttaaaaaggaggcaacactggtgctgaagtcc
atggaagatttccaaccagaactgtttggtttaccagcatatgattga

DBGET integrated database retrieval system