KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101526Help
Entry
102101526         CDS       T02921                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00140  Steroid hormone biosynthesis
phi01100  Metabolic pathways
Module
phi_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
phi_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102101526
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     102101526
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     102101526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_4 Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind NmrA KR Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 102101526
NCBI-ProteinID: XP_005523919
Position
Un
AA seq 377 aa AA seqDB search
MSLAGVSCLVTGAGGFLGQRIVRLLLEEEEALAEIRLLDKAFSHETLGRFDKFKGKTEVK
ILEGDIRDVTFLHRACQGVSLVIHTASLIDTLGLIEKKLLWEVNVTGTQLLLEACVRCNV
QHFIYTSTIEVTGPNCKGDPIFNGDEDTAYESTPKFPYAQSKRLAEDSVLKADGQVLKDG
GTLMTCALRSMYIFGEGCPFLQGHLDKCLLNKNVYLRFSRKEALVNPVYVGNIAWAHVQA
AKALRAPQKAKHIRGKFYYISDDTPHMSYADLNYELTKDLGFGIEPQLPMPLTVLYYFSL
LLEIVSFLLRPFVRYIPSTNRHLVTLLNTPFTFSYRKAQQDFGYVPHYTWEEAKKSTGEW
IASVIPQRRVCLQSSTA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggctggggtgagctgcctggtgacaggagcaggaggattccttggccagagg
attgtgcgcttgctgctggaagaagaggaggcgctggctgagatccgcctgctggacaaa
gccttcagccatgaaaccctcgggaggtttgacaagttcaagggtaagactgaggtgaag
atcctggaaggggacatccgagatgtcacattcctgcaccgtgcctgccagggggtctcc
ctcgtcatccacacggcttccctcatcgacaccctgggcctcatcgagaagaagctgctc
tgggaagtcaatgtaacaggtactcagctgctgctggaggcgtgtgtccgctgtaacgtc
cagcacttcatatacaccagcaccatcgaagtgacgggcccaaactgcaaaggtgacccc
attttcaatggtgatgaagatacagcttatgagagcacacccaaatttccttatgcccaa
agcaagagactggcagaggattccgtgctgaaagcagacggccaggtgctgaaggatggt
ggcacactgatgacctgtgccctgaggtccatgtacatttttggggaaggctgcccgttt
ctccagggccatctggataagtgcctgttgaacaagaacgtctacctgcgcttctccagg
aaggaggctctggtgaaccccgtgtacgtggggaacatcgcctgggcacacgtgcaggca
gccaaagccctccgagccccgcagaaagccaagcacatcaggggcaagttctactacatc
tcagatgacactcctcacatgagctacgctgatctgaattacgagctgaccaaggacctg
gggtttggaattgagccccagctgcccatgcctctgacagtgctctattacttctcgctg
ctgctggagatcgtgagcttcttgctccggccctttgtcagatacatcccctccaccaac
cggcacctggtcacactgctgaacaccccgttcaccttttcttacaggaaagcacagcag
gattttggctacgtgccccactacacgtgggaagaggccaagaagagcactggtgagtgg
attgcctctgtgatcccccagagaagggtgtgcttgcaaagcagcactgcctaa

DBGET integrated database retrieval system