KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102222Help
Entry
102102222         CDS       T02921                                 

Gene name
KHK
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00051  Fructose and mannose metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102102222 (KHK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102102222 (KHK)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     102102222 (KHK)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102102222 (KHK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 102102222
NCBI-ProteinID: XP_005532781
Position
Un
AA seq 306 aa AA seqDB search
MAAEAGGAAGKRRIMCVGLVCLDIISVVKDFPAEDSETRCLSQRWQRGGNASNSCTVLSL
LGAPCAFMGSLAPGPAADFIAADFQRRGVDTAHVAWHPRGDVPCACCLVNATSGSRTIVL
HDTNLPDLTARHFERVDLSQYKWIHFEARNAAEQSAMLDRVERHNRAAAPGRRVRISVEV
EKPREELLPLMGRGHVVFISKDLAQHFGYLSAPEALQGLRGRIQPGATLICAWAEEGADA
LGPDGELVHSDAFPPETLVDTLGAGDTFNAAVIFALAEGRTLQDALTFGCQIAGRKCGIQ
GFDGIV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaggcgggcggcgcggcggggaagcggcggatcatgtgtgtggggctggtg
tgcctggatatcatcagcgtcgtgaaggatttcccagccgaggattctgaaaccaggtgc
ctgtcacagcggtggcagcggggcgggaacgcctccaactcctgcacggtgctgtcgctg
ctgggagccccctgcgccttcatgggctcgctagcccccggccccgccgccgacttcatc
gcggcggatttccagcgccggggtgtggacacggcgcacgtggcgtggcatccccgcgga
gatgtgccctgcgcctgctgcctcgtcaacgccaccagcggctcccgcaccatcgtcctg
cacgacacgaacctgcctgacctgacagcccgccacttcgagcgggtcgacctttcccaa
tacaagtggatccacttcgaggcccggaacgcggcggagcagagcgcgatgctggatcgg
gtggagcggcacaaccgggcggcggcgccggggcggcgggtccggatctcggtggaggtg
gagaagccgcgggaggagctgctgccgctgatggggcggggacacgtggtgttcatcagc
aaggacctggcccagcacttcgggtacctatcggcccccgaggccctgcagggactgcgg
ggacgcatccagccaggggccacgctgatctgcgcctgggctgaggagggagctgatgcc
ttggggcccgacggggaactggtgcactcggacgccttccccccagagaccctcgtggac
acactgggggctggggacaccttcaatgccgccgtcatctttgctctcgcagaagggagg
accctgcaggacgccctcaccttcggctgccagatcgcgggcaggaaatgtgggatccag
ggcttcgatggcattgtctga

DBGET integrated database retrieval system