KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103258Help
Entry
102103258         CDS       T02921                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04010  MAPK signaling pathway
phi04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102103258 (CACNA1I)
   04020 Calcium signaling pathway
    102103258 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phi04040]
    102103258 (CACNA1I)
Ion channels [BR:phi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102103258 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 102103258
NCBI-ProteinID: XP_005527796
Position
Un
AA seq 2193 aa AA seqDB search
MAEYIPQPPSTWPAGPQPPHASAIFPLEPVDLGISEPQTPPEQPPSSLELGEDEEVTSPP
DPDVPYPDLAPVVFFCLKQTTSPRSWCIKMVCNPWFECVSMMVILLNCVTLGMYQPCEDM
DCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEY
SLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGI
IGVQLWAGLLRNRCFMEENFTVQGDIVLPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPP
LKERGHECCLDKDDYYYYNSVRQEFNISGMCVNWNQYYNVCRTGNANPHKGAINFDNIGY
AWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETK
QREHQLMQEQRARYLSSSTVASYMEPGDCYEEIFQYVCHILRKAKRRTLGLYNSVQSWRH
GHVQEPGKAKPSGNRKSQRHYRLCQQHNSLGCPPQGLVQPIAVTATSDPTNCPRCHRAEH
EASRRLSVLDSAGSDQEDGGASEGEGEGSQEDQGASALEKEEEVEEGGRLKLCSDMWREV
RVKLRVIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTNILEISNVVFTSMFALEMIL
KLAAFGLFDYLRNPYNIFDSIIVIISIWEIIGQADGGLSVLRTFRLLRVLKLVRFMPALR
RQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLW
AIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEG
DANRSYSDEDQSSSNMEEFDQFQEVQEGSDPKLCAIPVTPNGHLDPSLPSSNPPVVSGGV
TNSSRNSLQLDQIRVAVGSRKSSVISLGRMTYDQRSLSSSRSSHYGAWSRSGAWGSRRSS
WNSLARGHSLKHKPPSAEHESLLSGETHKAADGEPDRTGRVFHHRRTLSLDNKGSCDLLE
LASLPSGHRVTHRLGAPPGASEHQDCNGKMPSIVKEIFPKMNNHKERGEDDDEIDYSLCF
RIRKMMEVYKPDWCELREDWSIYLFSPQNRFRLLCQTVIAHKLFDHVVLAFIFLNCITIA
LERPQIEHRSTERIFLTVSNYIFTAIFVAEMTLKVVSLGLYFGDQAYLRSSWNILDGFLV
FVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGN
IVLICCAFFIIFGILGVQLFKGKFYHCLGVDIRNITNRSDCVAANYKWVHHKYNFDNLGQ
ALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFVG
VVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHIRLLIHSVCTSHY
LDIFITFIICLNVVTMSLEHYNQPVSLETALKYCNYLFTTVFVFEAVLKLVAFGLRRFFK
DRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRAL
LDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAF
LTLFQVSTGDNWNGIMKDTLRDCSHDDRSCLSNLQFISPLYFVSFVLTAQFVLINVVVAV
LMKHLDDSNKEAQEDAEMDAELEMEITHGLCSHKSGSPNSGQGKGAGTGGGGGRTDPEGH
LCMRCYSPAQENLWLDSVSLIIKDSFDGELMIIDNLSGSVFHHYSSPAMCEKCNHDKQEV
QLAEMEALSLNSDKSSSILLGDESDNRNTAQLNPKEIKDGQDNPDSTGADNLEECLLPAS
SEDGSANPDSYLCEMENTSFNSVQSWLKHESTKVPPSPFSPGASSPLLPVPTEFFHPAIS
ATQTGPEEVSCPHNLPKISLQGSWASLRSPGVNCSLLHQPPESDPSLDSGSSSSAGSLQT
TLEDNSLNLSDSPQCALDLPVALCPVPAAGSQRPLAAPLSPASRRRSLRGRGLFSLRSLC
RHQRSHSSGGSTSPGCTHHDSMDPSDEEGAGSSLRGGGNNSEPSETLSSLSLTSLFSPPP
AALTLVKKCSSTSSLQASPSPRRPAAHHAKPFYTVDPRGFLSMPSWVTDFCKDTPSPREG
EAPDGPGRLGTGDRSSPLPSELELGDGVSKRNR
NT seq 6582 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtacatcccccagcctccctccacctggcccgcaggcccacagccccctcac
gcttctgccatcttcccactggagcctgtggatctggggatatcggagccacaaacacca
ccggagcagccaccgtcctccctggagctgggtgaggatgaagaagtcacctcccctcca
gatcctgatgtcccctatccagacttggccccagttgtcttcttctgcttgaagcagacc
accagcccacggagctggtgcatcaaaatggtgtgcaacccctggttcgagtgtgtcagc
atgatggtgattttgctaaactgtgttaccctgggaatgtaccagccatgtgaggatatg
gactgcctttctgacaggtgtaaaatcttgcaggtgtttgatgatttcatcttcatcttc
tttgccatggaaatggtcttgaagatggtggccctggggatatttggcaagaagtgttac
cttggagatacctggaaccgcttggatttcttcattgtcatggctgggatggtggagtac
tccctggatctccaaaacattaacttgtctgcaatccgtacagtccgtgtcctgagaccc
ctgaaagctatcaaccgtgtgcccagcatgcgcatccttgtgaacctgctcctggacacc
ttgcccatgctggggaacgtccttcttctctgcttctttgtcttcttcatctttggcatc
attggggtgcagctgtgggctgggctgctccgcaaccgctgcttcatggaggagaacttc
acagtacaaggtgacattgtcctgcccccttattaccagccagaggaagatgatgagatg
ccctttatctgctcgctgtcaggagacaatggaattatgggctgtcacgaaataccccca
ctgaaggagcgaggccatgagtgttgtttggacaaggatgattattattattacaattca
gtccggcaagagttcaatatcagtggcatgtgtgtgaactggaaccagtactacaacgtg
tgccgcaccggcaacgccaacccgcacaagggtgccatcaactttgacaacattggctat
gcctggattgtgatatttcaggtgatcacactggaagggtgggtagagatcatgtactat
gtgatggatgcccattccttctacaattttatctactttatcttgttgataatcgtgggc
tccttcttcatgatcaacctgtgcctggtggtcatcgccacgcagttctcggagaccaag
cagcgggagcaccagctgatgcaggagcagagggcccgctacctctcctccagcactgtc
gccagctacatggagccgggagactgctacgaggagatcttccagtacgtctgccacatc
ctgcgcaaggccaagcgccgcaccctggggctgtacaacagcgtgcagagctggcgccac
ggccacgtgcaggagcccggcaaggccaaacccagcgggaacaggaaaagccagaggcac
tacaggctttgccagcagcacaactctcttggctgccctcctcagggcttagtccagccc
atcgctgtgacagcaacctctgatcccaccaactgcccacgatgccatagggcagaacat
gaagcatccagaaggctctcagtcctggatagtgctggctcagaccaggaggatggagga
gccagtgaaggggagggagagggcagccaagaggaccagggtgcctcggcgctggagaag
gaggaggaggtggaagaaggaggccggctgaagctctgcagtgacatgtggcgagaagtg
agggtcaagcttcgagttattgtggacagcaagtatttcaaccgggggatcatgattgca
atcctagtgaacaccatcagcatgggcattgagcaccacgaacagccagaggaattgacc
aacatcttggagatcagcaatgttgtctttacaagcatgtttgccctggagatgatcctg
aaacttgctgcttttggtctctttgactaccttcgcaacccctacaacatctttgacagt
atcatcgtcatcatcagcatctgggagatcattggccaggcagacgggggcctctctgtg
ttgaggacattccgactcctccgggtgctgaagctggtgcgtttcatgccagcgctgcgc
cgccagcttgtggtgctgatgaagactatggacaacgtagccaccttctgcatgctcctc
atgctcttcatcttcatattcagcatcctgggaatgcacatctttggttgcaagttcagc
ctcaggacagacacaggagatacagttcctgaccggaagaattttgactccctgctgtgg
gccattgtcaccgtctttcagatcctaacacaggaggactggaatgttgtactctataat
ggcatggcctccacctcaccgtgggcttccctttactttgtggctctcatgacatttggc
aattatgtactctttaatcttctggtggccattcttgtggagggattccaggctgagggt
gatgccaaccggtcatactcagatgaagatcagagttcttcaaacatggaagagtttgat
caattccaagaggtccaggaaggctcagatcccaaactctgtgcaattcctgtgacacct
aatgggcacctggacccatccttgccctcttccaacccaccagtggtttctgggggagtc
accaactcttcacgcaactcactgcaacttgaccagatccgtgttgctgttggctcccgg
aagagcagtgtgatatccctggggagaatgacttatgaccagcggtccttgtccagctcc
cgcagttcccactacggcgcctggagccgcagcggagcctggggaagccgtcgctccagc
tggaacagcctggcccggggacacagcctgaaacacaaacctccctcagctgagcatgag
tccctcctgtctggggaaacgcacaaggcagcagatggggagccggatcggacaggaagg
gtgtttcatcaccgccggacactctctctggataacaaaggctcctgtgacctgctggag
ttggcctcactcccttctggccacagagtgacccacaggctgggagcaccgcctggggcc
agtgagcatcaggactgcaatggcaaaatgcccagcattgtcaaggagatcttcccaaag
atgaacaaccacaaagaacggggagaggatgatgatgaaatagattatagcctgtgcttt
cgcatccggaagatgatggaagtctataagccagactggtgtgaattacgggaagactgg
tccatatatctcttctctccacagaacaggtttcgcctcctctgccaaaccgtcattgct
cacaagctctttgaccacgtagtgctggccttcatcttcctgaactgcatcacgattgcc
ctggaaagacctcagattgaacacagaagcacggaaagaatctttctcactgtgtccaac
tacattttcacagcaatctttgtagctgagatgacactgaaggtggtctctctaggccta
tattttggggaccaagcttatctccgcagcagctggaacatcttggatggcttcttggtc
tttgtgtctctcattgacattgtggtctcagtggcctctgctggtggtgccaaaatcctg
ggggtgctgcgagtgctccggttgctgcgcacactacgtcccctccgagtcatcagtcga
gcccctggtctgaagctggtggtggagacacttatttcttccctcaagcccataggaaac
attgtcctcatctgctgtgctttcttcatcatctttggcatcctgggagtgcagcttttc
aagggcaagttctaccactgcctgggggttgacatcaggaacatcaccaaccgctccgac
tgcgtggcagccaactacaagtgggtgcaccacaagtacaactttgacaacctgggacag
gctctgatgtccctctttgttttggcttccaaggatggctgggtcaatattatgtacaat
ggacttgatgctgtggctgttgaccagcagccagtgacgaacaacaacccctggatgcta
ctctacttcatctcctttctcctcatcgtcagtttctttgtgctcaacatgtttgtgggg
gtggtggtggagaacttccacaagtgccggcagcaccaggaggctgaggaggcgcgccgg
cgggaggagaagcgcctgcgacgcttggagaagaagcgaaggaaggcgcagcgtttgccg
tactatgctacctactgccacatacgcctccttatccattcggtctgcaccagccactat
ctggacatcttcatcactttcatcatctgcctcaacgtggtcactatgtccttggagcac
tacaaccaacctgtgtccctggagaccgccctcaagtactgcaactacctgttcaccact
gtctttgtgtttgaggcagtcctcaagctggtggcatttggtctgcgacgattcttcaag
gacaggtggaaccagctagatctggcgattgtgctgctgtctgtcatgggcatcacattg
gaagagattgaaatcaacgctgctctcccaattaatcccactatcatccggatcatgaga
gtgctgcgtattgcccgggtcctgaagctcctgaagatggccacaggaatgcgagcactg
ctggatacagttgttcaagctctgccacaggtgggaaaccttggactccttttcatgctc
ctctttttcatctacgctgctctgggagtggagctctttggaaaactggtgtgcaacgat
gagaacccctgtgaaggcatgagccgccacgccaccttcgagaactttgggatggccttc
ctcacacttttccaggtgtccacaggagacaactggaatgggatcatgaaggataccttg
cgtgactgcagccacgatgaccggagctgtctcagcaacctgcagttcatctccccactg
tactttgtcagctttgtgctcacagcccagtttgtcctcatcaacgtggtggtagctgtg
ctcatgaaacatcttgacgacagcaacaaggaggcccaggaggatgcagagatggatgct
gagcttgagatggaaattactcatgggctatgctcccacaagtcaggctctccaaattca
ggacagggaaaaggagcaggaacaggaggaggtggtggtagaacagatcctgaaggacat
ctgtgcatgagatgttactctccagcccaggagaacttatggctggacagtgtctcttta
attattaaggactccttcgacggggagttaatgatcatcgataacctatcgggctccgtc
ttccatcattactcctcgccggccatgtgcgagaagtgtaaccatgacaagcaagaggtc
cagctggctgaaatggaagcgttatccctcaactcagacaagtcctcttccatccttcta
ggagatgagtcagacaatcgaaatactgctcagctgaatcctaaggagatcaaggatggc
caggacaaccctgactccactggggcagacaatctggaggaatgcctgcttccagcatcc
agtgaggatggctctgcaaacccagacagttacctgtgtgaaatggagaatacttctttc
aactccgttcaatcttggctaaagcatgaaagtaccaaagtccctcccagccccttctct
ccaggtgcatcttcccctctgttacccgtaccaacagaatttttccacccagccatctct
gccacccaaacagggcctgaggaagtctcgtgtccacacaaccttccaaagatctccctg
caaggctcgtgggcatcactgagatctccaggtgtgaactgctcacttctccatcagccc
cccgagagcgacccgtctctggacagcggcagcagcagctcggccggcagcctgcagacc
acgctggaggacaacagcctcaacctcagcgactctccgcagtgtgccctggacctgccg
gtggctctgtgccccgtgccggcggcgggcagccaaagacccctggcagcccccctgtcc
cccgcctcccgccgccggagcctgcggggccgggggctcttcagcctgcggagcctgtgc
cgccaccagcgcagccacagcagcggcggcagcaccagccccggctgcacccaccacgac
tccatggacccttcggatgaggagggggcgggcagcagcctgcgcgggggtggcaacaac
agcgagccctcggagacgctcagcagcctctcgctgacctcgctcttctcgccgcccccg
gcggcgctgaccctggtgaagaagtgcagcagcaccagcagcctccaggccagcccctcg
ccccgccgccccgccgcccaccacgccaagcccttctacaccgtcgaccctcggggcttc
ctctcgatgccctcctgggtgacggacttctgcaaggacaccccctcgcccagggaagga
gaggcgccagacggccccggcagactggggacaggggaccgcagctccccgctcccttcc
gagctggagctgggcgacggagtcagcaagaggaacagatga

DBGET integrated database retrieval system