KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104265Help
Entry
102104265         CDS       T02921                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00020  Citrate cycle (TCA cycle)
phi00310  Lysine degradation
phi00380  Tryptophan metabolism
phi01100  Metabolic pathways
phi01200  Carbon metabolism
Module
phi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phi_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102104265 (DLST)
  09105 Amino acid metabolism
   00310 Lysine degradation
    102104265 (DLST)
   00380 Tryptophan metabolism
    102104265 (DLST)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     102104265 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 102104265
NCBI-ProteinID: XP_005520317
Position
Un
AA seq 460 aa AA seqDB search
MVPLWRSRCLGRALGRSLRALRQGNCTLARCPLSGVSGSQGLAYTNSRKLVVNSSSVFTV
RYFRTTAVHRDDVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPA
PAAGVIEALLVPDGGKVEGGTPLFKLRKTGAAPAKAKPAAAPPPPAAPEPVAAPAPPPAA
APIPTTMPPVPPVSTQPIDSKPVSAVKPAAAPAAAPPGEAVPTKGARSEHRVKMNRMRQR
IAQRLKEAQNTCAMLTTFNEIDMSNIREMRTVHKDTFLKKHNLKLGFMSAFVKAAAFALQ
DQPVVNAVIDDTTKEIVYRDYVDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGEK
ARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKIEVR
PMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgctgtggcggtcccgctgcctcggccgcgcgctgggccgctcgctgcgcgcc
ctccgacaggggaactgtactctggcaagatgccctctgtctggtgtgtctgggagccaa
ggactggcttacacaaacagcaggaagcttgtagtaaatagctccagtgtcttcactgtc
cgctacttcagaaccactgcagtacatagggatgacgtggttactgtgaacacaccagcc
tttgcagagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtg
gcggaagatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagcc
ccagcagctggtgtgatcgaagcccttctggtacccgatggtggcaaagtggaagggggg
acacctctattcaaactcaggaaaactggagctgcacctgccaaggctaaaccagcagca
gcccctcctcctcctgcagcccctgaacctgtagctgcgcctgctcctccccctgctgca
gcaccaattcccactacaatgccaccagtgccacctgtgtcaactcagcccatcgacagc
aaaccagtgtctgctgtgaagccggctgcagccccagcagcagccccccctggggaggca
gtgcccaccaaaggtgccagatcagagcatagggtgaaaatgaataggatgcgtcagcgt
attgctcagcgtctgaaagaggctcagaatacttgtgccatgctgaccactttcaatgag
atcgatatgagcaacatccgggagatgagaactgtacacaaggatacctttctgaaaaag
cacaacctgaagctaggattcatgtcagcttttgtgaaagctgcagcctttgctctgcag
gaccagcctgttgtgaatgcagtgatcgatgacacgaccaaagagattgtgtacagggac
tatgtggacatcagtgtcgctgtagcaactccccggggtctggtggtccctgtggttagg
aatgtagaaaacatgaactttgctgacatagagcgtgctatctacgagctgggggagaag
gcacggaagaatgaactggccattgaagacatggatggtggcactttcacaatcagcaat
ggtggggtttttgggtcactctttggaacacctatcattaacccaccccagtctgccatc
ttaggcatgcatgccatctttgacaggcctgtggctgtgggaggcaagatcgaggtgcgg
cctatgatgtacgtggcgctgacctacgatcaccggctcatcgacggcagagaggccgtg
accttcctgcgcaagatcaaggcagcggtggaggatccccgcgtgctgctgctcgacctg
tag

DBGET integrated database retrieval system