KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104310Help
Entry
102104310         CDS       T02921                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04012  ErbB signaling pathway
phi04020  Calcium signaling pathway
phi04114  Oocyte meiosis
phi04217  Necroptosis
phi04261  Adrenergic signaling in cardiomyocytes
phi04310  Wnt signaling pathway
phi04912  GnRH signaling pathway
phi04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102104310 (CAMK2B)
   04310 Wnt signaling pathway
    102104310 (CAMK2B)
   04020 Calcium signaling pathway
    102104310 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102104310 (CAMK2B)
   04217 Necroptosis
    102104310 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102104310 (CAMK2B)
   04916 Melanogenesis
    102104310 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102104310 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phi01001]
    102104310 (CAMK2B)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102104310 (CAMK2B)
Protein kinases [BR:phi01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   102104310 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 SnoaL_2 APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 102104310
NCBI-ProteinID: XP_005532956
Position
Un
AA seq 542 aa AA seqDB search
MATTVPCTRFTDEYQLYEEIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPPTMSAAAAGAPLGLVEQAKSLLNKKADGVKPQTNSTK
GSAGVTSPKGTLPPTALEPQTTVIHNPPDGTKESSDSTNTTIEDEDTKARKQEIIKITEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLSKNNKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDAQGRPRTSQSEETRVWHRRDGKWQNVHFHGSGAPVAP
LQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgtgccctgcacccgtttcaccgacgagtaccagctctacgaggagatc
ggcaagggagctttctcggtcgtccggcgctgcgtcaagctctgcactggccatgagtac
gctgctaagatcatcaacaccaaaaagctctcagccagagaccaccagaagctggagcgg
gaggcgcgtatctgccggctgctcaagcactccaacatcgtgcggctccacgacagcatc
tctgaggaggggtttcattacctcgtctttgacctggtgacgggtggagagctctttgag
gacatcgtggcacgggagtactacagtgaggctgatgccagccactgcatccagcagatc
ctggaagctgtcctgcactgtcaccagatgggggtggtccacagagacctcaagccggag
aacctgcttctggccagcaagtgcaaaggggcagcagtgaagctggcggactttggcctt
gccatcgaggtgcagggggatcagcaggcctggtttggatttgccggcacacctggctac
ctgtcccctgaggtcctgcgcaaggaggcctatggcaaaccggtggacatctgggcatgt
ggggtcatcctgtacatcctgctggtgggctacccgccgttctgggatgaggaccagcac
aaactctaccaacaaatcaaggccggggcctatgatttcccttcacctgagtgggacaca
gtcacccccgaagcaaaaaacctcatcaatcagatgctgaccatcaaccctgccaagcgc
atcacagcccacgaggccctcaagcacccgtgggtctgccaacgttctaccgtggcctcc
atgatgcacaggcaggagacagtggagtgcttgaaaaagttcaatgcccggaggaagctc
aagggtgccatcctcaccaccatgttggctaccaggaacttctcagtgggcagacagacc
accgctcctcccaccatgtcggcggccgctgccggggcccccctggggctggtggaacaa
gctaagagcttactgaacaagaaggcggacggtgtgaagccccagaccaacagcaccaaa
ggcagtgctggtgtcaccagccccaaggggaccctcccgcccaccgctctggagcctcaa
actactgtaattcataaccccccggacggcaccaaggagtcctccgacagcaccaacacc
accattgaggacgaggacaccaaagcccgcaagcaggagatcatcaagatcacggagcag
ctcatcgaggccgtcaacaacggggacttcgaggcctacgcgaagatctgcgatccgggg
ctcacctcctttgagcccgaggcactgggcaacctggtggaggggatggacttccaccgc
ttctactttgaaaacttgctctccaagaacaacaagcccatccacacgaccatcctgaac
ccacacgtgcacgtcatcggggaggacgcggcctgcatcgcctacatccgcctcacccag
tacatcgacgcgcagggccggccccgcaccagccagtccgaggagacccgcgtctggcac
cgccgcgacggcaagtggcagaacgtccacttccacggctcgggggcccccgtcgccccg
ctgcagtga

DBGET integrated database retrieval system