KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104821Help
Entry
102104821         CDS       T02921                                 

Gene name
PIK3C2A
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00562  Inositol phosphate metabolism
phi01100  Metabolic pathways
phi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102104821 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102104821 (PIK3C2A)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     102104821 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 102104821
NCBI-ProteinID: XP_005522360
Position
Un
AA seq 1700 aa AA seqDB search
MDICSCGMAQISSSNGFKQRSSPSLSAPRPKDVDKEEALQMEAEALAKMQKERGVAGNKQ
TFHSLGSPRKKAQTHNKQDHDLMVFPESDAKSMEDKLSTIDIEKLTHAELEKLLLDDNFE
SSKVPTLPASPLLSPSMSSQFYRGPAGQRRQWTPGIPAPVTCTLPPIYTSASYTKQIGVF
QNGFHPSMSSYPSREPIYLGLPRQSQYISYPLAATTPFHPHRGLPLYPPVLTPEMAKVFD
KIASTSEFLRNGKSSTDLEMTSIKSAVSNLPASESCRDVSKFDWLDLDPLSKPKVDTVET
LNKAEDDGERASSMTAEDPWDAVLLEEKLLLTCHLERKVNGKSSGAAVTRSQSLNMRTTQ
IAKLQGQTSQKDCGTTGTLTENVLLQAIEGQNQELSAFSEAVTKLRTKFPYTDQQTNPGF
VLSPIMLQRNISGESASIKVSIEIEEFQQPVTFTCDVSSPVELIIMQALCWVHDDLNEVD
IGSYILKVCGQEEVLQNKHCIGSHEYIQNCRKWDTDIKLQLLTHSGICSDLARTEDDDRT
PVHLTKHLCKVEKPFREPIIRSSIEELLEVYHKQVNIALKNENQHKAVDHVIKTVRKICS
TLDCVETPAITESVKKLRRAVNLPRIKNAEVSLKYGDDNSKSPSGSLRPENPLKVSIDQL
TRAVEALLQLHTNSCSRSATISPEESKSTKEAWTATEHLQFTIFAAHGISSDWVSNYEKY
YLICSLTHNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLCLTLFGI
LNQSSGSSPDSNRQRKGPEILGQVSLPLFDFRRLLTCGTKLLQLWTSSHLHHVSGMASKK
GNTERIVLQIDFPSLSFDIEYKMPQAAKSTVHRSVETLEKPLRERLLAILSKDSTIGLSK
EDKEFLWEKRHYCHSHPNSLPKILVSAPHWDLASLPEIYSLLQQWPPLSPLAALELLDSK
FADQEVRSTAVNWIETLSDDELTDFLPQFVQALKYETYLDSALVKFLLARALGSIRIAHY
LYWLLKDTLYDTKFGIRYEQILGAFLSVCGKRLREELEKQTRLVQLFGMVAERVKQTSGS
ARQVALQNGMERVQLFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKVALINADPL
GEEINVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVELVPA
SDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLGIC
DRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRF
QLFVDLCCQAYNLIRKHASLFLNLLSLMLSSGLPELSGIQDLKYVQDALQPQTTDAEATI
FFTRLIESSLGSVATKFNFFIHNLAQLRFSGLPSNDEAILSFSAKTYSLKQDGRIKQVSV
FTYQKRYNPDKHYIYVVRVLREGQVEPTFVFRTFDEFQELHNKLGILFPLWKLPGFPNKM
VLGRTHIKDVAAKRKVELNSYIQSLMNSSPEVAECDLVYTFFHPLLRDDKVEGIDGIARP
ADTSPSSPTSGKVGGEVKLSISYRNSTLFVMVMHIKDLVTEDGADPNPYVKTYLLPDTHK
TSKRKTKISRKTRNPTFNEMLVYSGYSMETLKQRELQLSVLSAESLRENFFLGGITLPLK
DFNLSKETVNWYRLTAVPYV
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atggacatctgctcttgcggcatggcccagatatccagcagcaatggattcaaacagcgt
tcctcaccttctctgtcagccccgaggccaaaagatgtggacaaagaagaggcactccag
atggaagctgaggcattagccaaaatgcagaaggaaagaggtgtagctggtaataaacaa
acttttcattctttaggcagccccagaaaaaaagcacagactcataacaaacaggaccat
gatctcatggtgtttccagagtctgatgccaagagcatggaagataaactaagtaccatt
gacatagagaagcttactcatgctgaactagagaaactgctactggatgacaattttgaa
tctagtaaagtacctacattaccagcaagtcctcttttgagcccgtctatgtcttctcaa
ttttatcgtgggcccgcaggtcagaggagacagtggacacctggaataccagcacctgtg
acatgcactttacctcctatttacacctcagcttcttacacaaaacagattggtgtattt
cagaatggattccatccaagtatgtcgtcctatccctctagagagcctatttatcttggt
cttccaagacagtcacaatacatttcatacccactggcagctaccacacctttccatccg
cacagaggcctacctttatatcctccagtactcactccagaaatggcaaaagtatttgac
aaaattgcaagcacttcagaattcctgagaaatgggaagtcgagcacagacctagaaatg
acttctataaagtctgcagtgtccaacctgccggcctcggagagctgcagggatgtcagt
aaattcgattggttggatttggatcctctcagtaaaccaaaagtggatactgtggagact
ttaaacaaggcagaggatgatggagagagggcttcaagtatgactgctgaagatccgtgg
gatgctgttctgttagaggaaaagctgttactaacttgtcatctggaaagaaaggttaat
gggaaatcttctggagcagcagtcacaaggagtcagtccttaaacatgagaacaactcag
attgcaaagttacagggccaaacatcacagaaagactgtgggaccacgggcacgctgaca
gaaaacgtgcttctccaagcaattgaagggcagaatcaagagctgtcagctttttctgaa
gcagttacaaaactgaggaccaagtttccttatactgatcagcaaacaaacccaggtttt
gtgctgagtccaatcatgctgcaaagaaatattagtggggagagtgccagtatcaaagtt
tcaatagaaatcgaagaattccaacaaccagtaactttcacatgcgatgtgagttcccct
gttgaacttataataatgcaggcactctgctgggtgcatgatgacttgaatgaagtggac
attggcagctatatcctgaaagtctgtggccaagaagaagttttacagaacaagcactgc
ataggaagtcacgagtacatccagaactgccgcaagtgggacacggacatcaaactgcag
ctcctgacccacagcgggatatgcagcgacctggcacgaacagaagatgatgacaggaca
cctgtacatctaaccaagcacctctgcaaagtagaaaagcctttcagagaacctatcata
agatcttccattgaagagcttcttgaggtttatcacaagcaagttaacatagcccttaag
aatgagaaccagcataaagcagtagaccatgtaattaagactgtcagaaaaatctgttct
acattggattgtgtagagactcctgcaataacggaatcagtgaagaagctcaggagggct
gttaatctcccaaggattaaaaatgctgaggtatccttaaaatatggtgatgacaatagc
aagagcccctctggttcactgcggcctgaaaaccctctgaaagtgagtatagaccagtta
acaagagcagttgaggcccttctgcaactccacactaactcctgtagccgttcagcaaca
atttctccagaagagagtaagagtaccaaggaagcttggactgccacagaacatctccag
ttcacaatatttgctgctcatggaatttcttctgattgggtgtcaaattatgaaaaatac
tacttgatttgttctctgacccataatggaaaagatctgttcaaacctgttcagtccaag
aaggttggcacatacaagaacttcttctacttgattaaatgggatgagctaataattttc
cccatccagatttcacagttgcctttggaatcagtcttatgtctgactttgtttggaatc
ctaaatcaaagtagtgggagttcccctgactcaaataggcagagaaagggcccagaaatt
ttgggtcaggtttctctacctctttttgattttaggcgactgttaacttgtgggacaaag
ctgttgcaactgtggacctcatcacatctgcatcatgtgtcagggatggccagtaagaaa
ggaaatacggaaagaatagtgttgcagattgacttcccatccctttcttttgacattgaa
tataaaatgcctcaagctgcaaagagtactgtgcatcgttctgtagaaacattagaaaag
ccgttgagagaacgtctccttgccattctctccaaggatagcaccattgggctgtcaaaa
gaagataaagaatttttgtgggagaagagacattattgtcatagccatcctaatagccta
ccaaaaatactggttagtgcccctcactgggacttggcaagtcttccagaaatatattca
ttacttcagcagtggcctcctttatcacccttagctgccctggaactacttgattcaaag
tttgctgatcaggaagtacgaagtacagctgtgaactggatagagacattgagcgatgat
gagttaacagatttcctccctcagtttgtacaggcattgaagtatgaaacctaccttgac
agcgctcttgtgaaatttcttttggctcgggcacttggaagcattcggattgcacactac
ttgtactggcttcttaaggatacactgtatgatacaaagtttggtataaggtatgagcaa
attcttggagcttttctttcagtctgtggaaaaaggctgagggaagagctggagaagcag
accaggctagtgcagctctttggaatggtagcagaaagagtaaagcaaacgagtggatct
gctcggcaggttgccttgcaaaatggcatggagcgtgtgcaattatttttcttgaagaac
aaatgccgtttgcctctcaatcccagtcttgtggcaaaagagttaaatattaaggcctgt
tctttcttcagctccaatgcagtaccactcaaagttgcactgataaatgcagacccgctg
ggagaagaaattaatgtgatgtttaaggttggagaagatctgagacaagatatgttggct
ttacaaatgattaagatcatggataagatctggctgcaggagggactggatctaagaatg
gttatcttcaagtgtctctcaactggaaaagaccgaggcatggtagagcttgttcctgct
tcagatacactcaggaaaattcaagtggaatatggagtgacaggttcttttaaggacaag
cctctggcagaatggttgcggaagtataatcctacagaggaggagtatgaaaaggcttca
gaaaacttcatctactcttgtgcaggatgctgtgtagctacttatgtcctgggaatctgt
gaccgccacaatgataacataatgctccggagcactgggcatatgtttcacatcgacttt
ggaaagtttttgggacatgcacaaatgtttggtagctttaaaagggatcgagctcctttt
gtgctgacatcagatatggcttatgtcattaatggcggggaaaaacccacaattcgcttt
caactgttcgtggatctctgttgccaagcttacaacttgataaggaaacatgccagcctc
ttccttaacctactttcattgatgctttcttctgggttaccagaactaagtgggattcag
gacttgaagtatgtccaggatgctctccagccccaaacaacagatgcagaagccaccatt
ttcttcacaagactgatcgaatccagtctgggaagtgttgccacaaagttcaatttcttc
attcacaacttggctcagctgcgtttctcaggtctgccttctaacgatgaggccatcctg
tcattttctgctaaaacctattctctcaaacaagatggccgaatcaaacaagtatctgtg
tttacgtatcagaagagatacaacccagataaacattacatctatgtagtgagagttttg
agagaagggcaagttgagccaacgtttgtcttccgaacatttgatgagttccaggagctc
cacaacaaacttggcattctctttcctctttggaagttaccaggctttcctaataagatg
gttctgggaagaacacacatcaaagatgtagcagccaaaagaaaagtggaactcaacagc
tacatacagagcctgatgaacagttctccagaggtggcagaatgtgatcttgtttatact
tttttccatccattacttcgtgatgacaaagtggaaggaatagatggaatagccagacct
gcagatacaagtccatcaagtcctacctcaggcaaagtgggaggagaagtgaagctatcc
atatcctatagaaatagcactctatttgtcatggtgatgcacatcaaagacctggttaca
gaagatggtgcagatccaaatccctatgtgaaaacttacttacttccagacacacataaa
acatccaaacgcaaaaccaaaatctcccggaagacaagaaacccaactttcaatgaaatg
ctcgtgtacagtggatacagcatggagactctgaaacagagggagctccagttaagtgtg
ctcagtgcagaatcgttacgtgagaacttcttcctaggtggaattacactcccactaaag
gacttcaacttgagcaaggagactgttaactggtatcgactgactgctgtaccctatgtg
tga

DBGET integrated database retrieval system