KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104926
Entry
102104926         CDS       T02921                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phi03000]
    102104926 (AHRR)
Transcription factors [BR:phi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102104926 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4 DUF1505
Other DBs
NCBI-GeneID: 102104926
NCBI-ProteinID: XP_005517398
Position
Un
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQAGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAVNTN
SSSKGSSGFCEATELYGRNNHHEGAAFSNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILNGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRLNTCPNRRAGSFYNRDQNFLNLASTCPSHWGSAENGQSYSGLQQRCAENYATD
HLKLQRPLISSESLYDTAIPLEMPIKTEYDSDSENIADNYLLSQSRAWLDESGSVRKQVS
SYPNRMHLKTEPDLCEPALPCQKSRHCLYTPHNWQCIIANHSNNLNLNRACKGSRNKEVA
PFCPQNSSVCLENMPDLPHTACYSHFYSPSPGEEKEQVNEGFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNTVHASFPENTLAGSVPRKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccaggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaatgagaaatccaatccttcgaagagacacagagaccgtctg
aatgcggaactggaccacctggccagcctccttccttttccacctgacatcgtatcaaag
ctggacaaactttccgttttgcgccttagtgtcagctatctccgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagctggccaaacgataaaagaagacaat
atatctaataagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcaacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcatgtggat
gaccgccaggatttttgtagacaactgcactgggccatgaatcctccccagatgttgtct
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagca
caagagaatgacagcatgacaacagattattcttcctttctaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcagttccaaggcaaa
ctaaagttcctctttggacaaagaaagaagtcctcatcaggaacagtattgccacctcag
ctgtccttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagcagtgaacacaaac
tccagttcaaaaggcagttcaggattttgtgaagcaacagaattatatggaagaaacaat
caccatgaaggtgctgccttcagtaatgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacagctgaagatactaaatggttttgcc
agtttgaaaggaaatctggaggggctttcctataacagtgccattgaaactctgggccag
tggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaatggtgagtgttttatgcaagaggaacctctcagttccaacacatca
gttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcaagt
tcttgttctatgagccagagactgaacacatgcccaaacaggagagctggatcattctac
aacagagaccaaaatttcttaaatttggcgtcaacttgtccttcccactgggggagtgca
gaaaatggccagtcttactcggggctccaacagcgctgtgcagagaactatgcaacagac
catctgaagctgcagagaccattaatatcctcagagtctctctatgacacagccattccc
ttggagatgcctatcaaaacagaatacgactctgattctgaaaacattgccgataactac
ctgctttcgcagagccgagcctggctggatgagagcggctcggtgagaaagcaggtgtcc
agctatcccaacagaatgcacctcaaaacagaaccggacctctgcgagccagccttgccc
tgccagaagtcaaggcattgcctttatacaccccataattggcaatgcatcatagcaaac
cattccaacaacctgaacttgaacagagcttgcaagggttcacggaacaaggaggtggcc
ccattttgccctcagaactcctccgtgtgtttggaaaacatgcctgacctgccacacaca
gcttgctacagccacttctacagccccagcccaggggaggagaaagagcaggttaatgag
gggttcaaaatgccatgtgaatttaaaaatccctgcttggttcaagccattaagcgtgag
ccccttgattctccaccattgtccaacagtggacagaacacagtacatgcaagcttccct
gaaaatacattagcaggttctgtgcctcgtaaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system