KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104958Help
Entry
102104958         CDS       T02921                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00350  Tyrosine metabolism
phi00360  Phenylalanine metabolism
phi00380  Tryptophan metabolism
phi01100  Metabolic pathways
Module
phi_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
phi_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102104958 (DDC)
   00360 Phenylalanine metabolism
    102104958 (DDC)
   00380 Tryptophan metabolism
    102104958 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phi04147]
    102104958 (DDC)
Enzymes [BR:phi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102104958 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     102104958 (DDC)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102104958 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102104958
NCBI-ProteinID: XP_005527890
Position
Un
AA seq 485 aa AA seqDB search
MDAAEFRKRGKEMVDYVADYLEKIEKRQVFPDVEPGYLRPLIAQCAPQDPESFEDVFKDI
EKIIMPGVTHWHSPYFFAYFPAASSFPALLADMLCGGIGCVGFSWAASPACTELETVMLD
WLGKMVNLPEEFLAGKDGKGGGVIQGSASEATLIALLAARTKTIRQVQSEKPELTEAEIM
GRLVAYASDQAHSSVERAALIGAVKIKNVPSDDTFSVCGSALKKVLDEDKAAGLIPFFFC
ATLGTTPCCSFDKLLELGPICNKENIWMHIDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRSDLIGAFKLEPLYLQHHHQESGLVTDYRHWQIPLGRRFRSL
KLWFVLRMYGVKGLQEHIRKHIRLSHQFEHLVLQDERFEICAKVVLGLVCFRLKGSNELN
EALLKSINGAKKIHLVPCHLREKFVLRFAICSRTVESTHIEFAWQHISQLATDLLKTWVQ
NHHQQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcagaattccgcaagagagggaaggagatggtggactatgttgcagactac
ctggagaagatagagaaacgacaggtattcccagatgtggaaccaggatatctacggccc
ctcattgcacagtgtgcaccccaggatcctgagagttttgaggatgtctttaaagacatt
gagaagatcattatgccaggggtgactcactggcacagtccatatttttttgcctacttc
cctgcagcctcttccttcccagctcttcttgcagatatgttgtgtggtggaataggatgt
gtgggcttctcttgggctgcaagtccagcttgcacagagctggagactgtcatgctggat
tggctagggaagatggttaatttgcctgaagagtttttagctgggaaggatggcaaaggt
ggaggagtcattcagggaagtgcaagcgaagccaccttgattgcactgcttgctgcaaga
acaaagactatcagacaggtgcagtcagagaagcctgagctaacagaagcagagatcatg
ggcaggctggtggcttatgcttctgatcaggctcattcatctgtggaaagggctgcacta
attggtgctgtgaagattaaaaatgttccttcagatgacacatttagtgtttgtggttca
gccctgaagaaagttctggatgaagacaaagctgctggtcttataccattctttttctgt
gcaacactgggaaccaccccttgctgctcctttgacaagctgttagagctgggtcctatt
tgtaataaggaaaatatctggatgcatattgatgcagcctatgcgggaagcgctttcatc
tgccctgaattcaggcatcttttaaatggagtggagtttgcagattcatttaactttaat
cctcacaaatggctgctagtgaattttgactgctctgcaatgtgggtgaaaaaaagatca
gatttaataggtgcctttaaattagaacctctctacctgcagcatcaccatcaggagtct
ggtcttgtaacagattatcggcactggcaaatccccctgggcagaaggttccgctccctg
aagctctggttcgtgctgaggatgtatggggtcaaggggctgcaggagcacatccgcaag
cacatcagactgtcacatcaatttgaacacttagtccttcaggatgaaaggtttgagatc
tgtgctaaggttgtcttgggactggtctgcttccggctgaagggctcgaatgaactaaac
gaggcacttcttaaaagcataaatggtgccaagaagatccatctggtcccgtgccacctg
agagagaagtttgtgctacgttttgctatttgctcccgcacagtggaatccacccatatc
gagttcgcctggcagcacatttcacagctggcaactgatctcctgaaaacatgggtgcaa
aaccaccaccagcagtaa

DBGET integrated database retrieval system