KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105395Help
Entry
102105395         CDS       T02921                                 

Gene name
MARS
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00450  Selenocompound metabolism
phi00970  Aminoacyl-tRNA biosynthesis
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102105395 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102105395 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phi01007]
    102105395 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phi03016]
    102105395 (MARS)
Enzymes [BR:phi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102105395 (MARS)
Amino acid related enzymes [BR:phi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102105395 (MARS)
Transfer RNA biogenesis [BR:phi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102105395 (MARS)
 Prokaryotic type
   Other AARSs
    102105395 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 GST_C_2 Anticodon_1 GST_C_3 APG6_N zf-C2HC5
Motif
Other DBs
NCBI-GeneID: 102105395
NCBI-ProteinID: XP_005532122
Position
Un
AA seq 900 aa AA seqDB search
MRLRVPPGAPAALKVLAAAGAAPAPVRPHLGGPAERPRSPPSPPRGPGLELELDNGTVLF
SANAICQYFYLCRGEEPTDLTTQWLEWEATELQPAVAAALYLRLVQGRPGPDTLGVLWHL
LAHLEQHLARSGTTHLAGDAASVADVVVWGSLFPVLQDETSLPSELQVLRSWFRAMSLWE
PCRDAAALLPEALRELRTHLAQHPPPLLAPRHEPQDEEGPERTLTDDDIAAAVDIWAQGP
AALPPPRQPRTPVLPVEGERNVLITSALPYVNNVPHLGNIIGCVLSADTFARYCRLRNWN
TLFVCGTDEYGTATETRALEEGLSPQELCDRYHAVHADVYAWFRISFDHFGRTTTPQQTR
IAQDIFQRLLARGFLLQDTLEQLRCESCGRYLADRFVEGTCPFCGYAEARGDQCDKCGKL
INAVELKSPQCKLCRGTPVVTPTQHLFLDLPKLEGQLEAWLERTWASGDWTANARHITRT
WLRDGLKPRCITRDLTWGTPVPLDGFRDKVFYVWFDAPIGYLSITANYTEQWERWWKNPQ
QVELYNFMAKDNVPFHSVVFPCSLLGADDNYTLVKHLIATEYLNYEDGKFSKSRGVGVFG
DMAKDTGIPADVWRFYLLYLRPEGQDSAFSWADLLLKNNSELLNNLGNFINRAGMFVCKF
FAGTVPDMVLTAEDQRLLARLTLEIRQYHQLMEKVRIRDALRCVLSISRHGNQYIQVNEP
WKRIKGDERDRQRAGTVTGVAVNVAAALAALLQPFVPGVSAAIQGQLRIPPERCGLGPGL
TCTLPAGHRVGTVSPLFQKLEPEQVEALRQRFGGTQAKEPPPASVPTPAPNTSAAPGDPK
LIQELTEQVAKQGNLVRQLKAAQAEKAQVDAQVAKLLELKQQLALAEGRSPEVPKGKRKK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccgggtcccgccgggcgctcccgccgccctcaaggtgctcgcggccgccggc
gccgcccccgcgcccgtccggccgcacctgggcggccccgcagagcggccgcgctccccc
ccgagccctccccggggtcccgggctggagctggagctggacaacggcaccgtcctgttc
tctgccaacgccatctgccagtatttttacctgtgccgaggggaggagcccaccgacctc
accacgcagtggctggaatgggaggccaccgagctgcagcccgcggtggccgctgccctg
tacctgaggctggtgcagggccggccggggcccgacaccctcggggtcctgtggcacctc
ttggctcacctggagcagcacctggcccggagcggcaccacccacctggccggggatgcc
gcctcagtggccgatgtggtggtgtggggcagcctattcccagtgctccaggacgagacc
agtctgcccagtgagctgcaggtgctgcgctcctggttccgcgccatgtccctgtgggag
ccgtgccgggacgcggccgcgctgctgccggaggcgctgcgggagctccggacccacctg
gcccagcaccccccgcccctcctggccccccgccacgagccccaggacgaggagggcccg
gagcggacgctgaccgacgacgacatcgcggctgccgtggacatctgggcccagggcccc
gcggcgctgcccccgccccggcagccacggacacctgtgttacctgtggagggagagagg
aacgtcctgatcaccagcgcgctgccctacgtcaacaacgtccctcacctgggcaacatc
atcggctgcgtcctcagcgccgacaccttcgccaggtactgccggctgcggaactggaac
acgctgttcgtgtgcggcacagacgagtacggcacggccacggagacgcgggcgctggag
gaggggctgagcccgcaggagctctgtgaccgctaccacgccgtgcacgccgacgtctac
gcctggttccgcatctccttcgaccacttcggccgcaccaccacgccccagcagaccagg
attgcccaggacatcttccagcggctgctggcgcgggggttcctgctgcaggacacgctg
gagcagctcaggtgtgagagctgtgggcggtacctggccgatcgcttcgtggagggcacc
tgccccttctgtggctacgccgaggctcgtggggaccagtgtgacaagtgtgggaagctc
atcaacgctgtggagctcaagagcccccagtgcaagctctgccgtggtaccccggtggtg
acgcccacccagcacctgttcctggacctgcccaagctagaggggcagctggaggcctgg
ctggagcgcacctgggcctcaggtgactggacggccaatgcgcggcacatcacgcgcacc
tggctgcgggatgggctcaaaccgcgctgcatcacccgcgacctcacctggggcacccca
gtgcccctcgacggcttccgtgacaaggtgttctacgtgtggttcgacgctcccatcggg
tacctgtccatcacagccaactacactgagcagtgggagcggtggtggaagaacccccag
caggtggagctctacaacttcatggccaaggacaacgtccccttccacagcgtcgtgttc
ccctgctcgctgctgggcgccgatgacaactacaccctggtgaagcacctcatcgccaca
gagtacctgaactacgaggatgggaaattctccaagagccggggcgtgggcgtgttcggg
gacatggccaaggacaccgggatccctgccgacgtctggcgcttctacctgctgtacctg
cggcccgagggccaggacagcgccttctcctgggccgacctcctgctcaagaacaactca
gagctgctcaacaacctgggcaacttcatcaacagggctggcatgttcgtgtgcaagttc
ttcgcaggtaccgtgcccgacatggtgctcacagctgaggaccagcggctcctggcccgg
ctcaccttggagatccgccagtaccaccagctgatggagaaagtccgcatccgcgacgcg
ctcaggtgcgtgctcagcatctcccgccacggcaaccagtacatccaggtgaacgagccc
tggaagcgcatcaagggcgatgagagggacaggcagcgcgcagggacagtgaccggtgtc
gcggtgaacgtggcggccgctctggccgcgctgctccagcccttcgtgcccggggtcagc
gccgccatccagggccagctccgcatccccccggagcgctgcggcctcgggcccggcctc
acctgcaccctgcccgccgggcaccgcgtcggcacggtgagccccctgttccagaaactg
gagcccgagcaggtggaagccctgcgccagcgcttcgggggaacgcaggccaaagagccc
cccccagcctcagtccccactccagcccccaacacttctgcagctccaggtgaccccaaa
ctgatccaggagctgactgagcaggtggccaagcagggtaacctggtgaggcagctgaag
gctgcccaggcagagaaggcccaggtggacgcccaggtggccaaactgctggagctgaag
cagcagctggcactggccgaaggccggagccctgaggtccccaagggcaagcggaagaag
tag

DBGET integrated database retrieval system