KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105403Help
Entry
102105403         CDS       T02921                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform-like
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00071  Fatty acid degradation
phi01212  Fatty acid metabolism
phi03320  PPAR signaling pathway
phi04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102105403
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102105403
   03320 PPAR signaling pathway
    102105403
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phi03029]
    102105403
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102105403
Mitochondrial biogenesis [BR:phi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102105403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102105403
NCBI-ProteinID: XP_014118398
Position
Un
AA seq 659 aa AA seqDB search
MAEAHQAVAFQFTVTPEGLDFQLSREAVRQLYLAAVHSWKKRLVRAKNSFLSGVYPASPS
SWMVVVLATAGSCYCHVDPSLGLIGRIQSWLPHGEALSPEARTAVSTVLFSTGAWLGAVL
LFRSLLRLLLSYHGWMFEPHGRMSRRTRLWIGATTVPAAAARRSPRVPSPQYLESVRPLL
DEERYQEMVALAKEFQEKTAPRLQRYLRLKSWWTTNYVSDWWEEYVYLRGRSPLMVNSNY
YAMDFLYVTPSPIQAARAANVVHSILLYRRRLDRGEIPPMMALGVVPMCSYQSERMFNTT
RIPGKETDSLLHLADSKHLAVYHKGRYYKVWLYYGGQLLAPAELEMQFQRILDDPSPPQP
GEERLAALTAGERAPWAEARARFFSRGPNKAALDAIERAAFFLTLDEEEHGHDPRKPGCM
DAYAKSLLHGRCYDRCFMLATDTFHLGYTEGGHCKGDPRRQLGPPQRLQWDIPAEAVAAI
EASLGVAQVQGVAAIDASLGVAQVQGVAAIDASLGVAQVQFMLATDTFHLGYTEGGHCKG
DPRRQLGPPQRLQWDIPAEAVAAIEASLGVARALAEDVDFCCFLFTTFGKGLIKRCRTSP
DAFIQIALQLAHFRDKGSFCLTYEASMTRLFREGRTETVRSCTCESTAFVRSMADPRRS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctcaccaggccgtggctttccagttcaccgtcacccccgagggcttggac
ttccagctgagccgcgaggccgtgcgccagctctacctggccgccgtccactcgtggaaa
aagcgcttggtccgcgccaagaacagctttctgagcggggtgtaccccgcgtcaccctcc
agctggatggtggtggtgctggccaccgccggctcctgctactgccacgtggatccgtcc
ctggggctcatcgggcgcatccagagctggctgccccacggcgaggcgctgagccccgag
gctcgcacggcggtcagcaccgtgctgttctccaccggggcctggctcggggccgtgctg
ctgttccggagcctgctccgcctgctgctctcctaccacggctggatgttcgagccgcac
ggccgcatgagccgccgcacccgcctctggatcggtgccaccacggtgccagcagcagca
gcccggcggtcaccgcgtgtcccctccccgcagtacctggagtcggtgcggccgctcctg
gacgaggagcgctaccaggagatggtggcgctggccaaggagttccaggagaagacggcg
ccgcggctgcagcgctacctgcgcctcaagtcctggtggacaaccaactacgtcagtgac
tggtgggaggagtacgtttacctgcgcggccgcagccccctcatggtcaacagcaactac
tacgccatggatttcctgtacgtgacccccagccccatccaggctgcgcgggcggccaac
gtggtgcactccatcctgctgtaccggcggcggctggaccggggcgagatccccccgatg
atggccctgggggtggtgcccatgtgctcgtaccagtcggagcggatgttcaacaccacc
cgaatcccgggcaaggagacggactcgctgctgcacctggcggacagcaaacacctggcc
gtgtaccacaagggccgctactacaaggtgtggctttactacggggggcagctgctggcc
cccgccgagctggagatgcaattccagaggatcctggatgatccctcgcccccgcagccc
ggggaggagcggctggcggcgctgacggccggggagagggctccgtgggccgaggcgcgg
gcgcgtttcttcagccgcggccccaacaaggctgccctggacgccatcgagcgcgcggcg
ttcttcctcacgctggacgaggaagagcacggccacgacccccgaaagcccggctgcatg
gacgcctacgccaaatccctgctgcacggccgctgctacgaccggtgcttcatgctggcc
accgacacgttccatctgggctacaccgagggggggcactgcaagggagacccccggagg
cagctgggccccccccagcgcctgcagtgggacatcccggctgaggcggtggcagccatc
gaggcgtcgctgggcgtggctcaggttcagggggtggcggccatcgacgcgtcgctgggc
gtggctcaggttcagggggtggcggccatcgacgcgtcgctgggcgtggctcaggttcag
ttcatgctggccaccgacacgttccatctgggctacaccgagggggggcactgcaaggga
gacccccggaggcagctgggccccccccagcgcctgcagtgggacatcccggctgaggcg
gtggcggccatcgaggcgtcgctgggcgtggcgcgggctctggccgaggacgtggatttc
tgctgcttcctcttcaccaccttcggcaaaggcctcatcaaacggtgccgcaccagcccc
gacgccttcatccagatcgcgctgcagctggctcacttccgagacaagggctccttctgc
ctgacgtacgaggcctccatgacgcggctgttccgcgagggccgcaccgagaccgtgcgc
tcctgcacctgcgagtccacggccttcgtgcgcagcatggccgacccccggcgcagc

DBGET integrated database retrieval system