KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105655
Entry
102105655         CDS       T02921                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00100  Steroid biosynthesis
phi01100  Metabolic pathways
Module
phi_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102105655 (TM7SF2)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102105655 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 102105655
NCBI-ProteinID: XP_014118239
Position
Un
AA seq 360 aa
MEPPRAPPPPELEFGGPWGAGALTLLLPLGLVEVVSASLGEGEGWGTPAPALPTPLTLAL
VLAWVGAHGLGSCWRPPRSPRETPGPLRDLGSAASSVAFGLGLVLLARRRLRGGGTGHPV
YEFFVGGELGSAPEPPESLHWERVGLCAWLLVLAAALGEQQRLWGSPSLPLVLVAAAQGV
PVLRRLRELSRNSPRGPGGFLGVFGALAWGPFGGPLPVLLLLRRPQNRLGGAGGAACGGL
YVLGLWIFHGATTQRRLFSRDPRDPRVAGLPTVPTATGQVLLAGGWWGLVRRPDHLGELL
MALGWTLPCGLSPPLLLLLAGAALRELRAVAGERQQLRRFGEAWGGLCQRVPHRLLPLVY
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggagcccccccgagcccctcctccccccgagctggaatttggggggccctggggcgcg
ggggctctgacgctgctgctgccgctggggctggtggaggtcgtgagcgcgagcctgggg
gagggggagggctgggggacccccgccccggccctgcccacccccctcaccctcgcgctc
gtcctggcctgggtgggcgcgcacgggctcgggagctgctggagacccccgaggagcccc
cgtgagacccccggacccctccgggacctcggctcggccgcgtccagcgtcgccttcggg
ctcgggctcgtcctcctcgcgcggcggcgactgcgggggggcggcaccggacaccccgtg
tacgaattcttcgtggggggggaactggggtccgcaccggagccccccgagagtctccac
tgggagcgggttgggctctgtgcctggctgctggtgctggcagcggctctgggggagcag
cagcggctttgggggtccccatcgctgcccctcgtgctcgtggcggccgctcagggggtc
ccggtgctgcggcgcctcagggagctgagcaggaattccccccgtggtcctggggggttc
ttaggggtctttggggctctggcctggggcccttttgggggtcccctcccggtgctgctg
ctcctgcggagaccccagaacaggctggggggagccgggggggccgcctgtggggggctc
tacgtcctggggttgtggattttccacggtgccaccacccagaggagactcttcagccgt
gacccccgagacccccgagtggccgggctccccacagtccccacggccacggggcaggtg
ctgctggcggggggctggtgggggctcgtccgccggcccgaccacctcggggagctgctg
atggcgttgggctggacccttccctgcggcctgtccccgccgctgctgctgctcctggcg
ggggctgcgctccgggagctccgagcggtcgcgggggagcggcagcagctgcgccgcttt
ggggaggcctggggggggctgtgccagcgcgtcccccaccgcctgctgccccttgtctac
tga

DBGET integrated database retrieval system