KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106204
Entry
102106204         CDS       T02921                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00230  Purine metabolism
phi00240  Pyrimidine metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102106204 (DCK)
   00240 Pyrimidine metabolism
    102106204 (DCK)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102106204 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 DUF5066
Other DBs
NCBI-GeneID: 102106204
NCBI-ProteinID: XP_005531791
Position
Un
AA seq 257 aa
MATPPKRCRPGGRLKKVAVEGNIAAGKSTFVNILKQASEDWEVVFEPVARWCNVQQSSGD
DREELTTSQKSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLNALDGKLRDAQNPVLFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWINKQFGSRLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFDYLQEIPILTLDVNEDFKGKK
DRYDHMIEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagcgctgcaggcccggcggccgcctcaagaaggtcgccgtggag
ggcaacatcgctgcagggaaatccacctttgtgaatattctgaaacaagccagcgaagac
tgggaagtggttttcgagcctgtagctagatggtgcaatgtccagcaaagctctggagac
gaccgtgaggagctgaccacgtcgcagaagagcggcgggaacgtgctgcggatgatgtac
gagaagccggagcgctgggcgttcaccttccagacgtacgcgtgcctcagcaggatccgg
gctcagctcaacgccctggatggcaaactccgggatgcgcagaatcccgtgctgttcttc
gagcgctctgtctacagcgacaggtacatctttgctgctaatttgtacgagtctgactgc
atgaatgagaccgagtggacaatttaccaggactggcacgactggataaataaacagttt
ggctccaggctggcgctggatgggatcatttatctccgagccactcctgagaaatgcttg
aataggatttatttgcgtggaagagatgaggagcaagaaatccccattgaatatctggag
aagcttcactacaagcatgaaagctggctccagcacaggacgctgcgaacagattttgac
tatctgcaggaaattccgattttaacgctcgatgttaacgaagacttcaaaggcaaaaag
gacagatacgatcacatgattgaaaaggtcaaggaatttttgagcacgttgtga

DBGET integrated database retrieval system