KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106903
Entry
102106903         CDS       T02921                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phi04040]
    102106903 (ASIC1)
Ion channels [BR:phi04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102106903 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 102106903
NCBI-ProteinID: XP_005532887
Position
Un
AA seq 527 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDIQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
TPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
ICEMPCNMTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTD
KGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaagtggacgaggaggaggtggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctgcacgggctctcacacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggcactttgcttcctgggctcactggctctgctcgccctc
gtctgcaccaaccgtatccagtactatttcctgtacccccacgtcaccaagctggacgag
gtggcggccaccaggctcacgttccccgccgtcaccttctgcaacctcaacgagtttcgc
ttcagccgagtgaccaagaatgacctgtaccacgccggagagctcctggccttgctcaat
aacagatatgagatcccagacatccagacagccgatgagaagcagctggaaatcctgcag
gacaaggccaacttccgaaacttcaagcccaaacctttcaacatgctggagttttatgac
cgggctggccacgacatccgggagatgctgctgtcctgcttcttccgtggggagcaatgc
acccccgaagacttcaaagtggtcttcacccgctacgggaagtgctacaccttcaatgcg
gggcaggacgggaagccacggctcatcaccatgaaggggggcactggcaatggcctggag
atcatgctggacatccagcaggacgagtacctgccagtgtggggggaaacagatgagacc
tcgttcgaagccgggatcaaggtgcagatccacagccaggacgagcctccgctgatcgac
cagctgggcttcggggtggctcccggcttccagacctttgtgtcctgccaggagcagagg
ctcatctacctgccgcctccctggggcgactgcaaggccgtggcgggcgactcggagttc
tacgacacctacagcatcacggcctgtcggatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggcgatgccccttactgcaccccggagcag
tacaaggagtgtgcggatccggccttagatttcctggtggagaaggacaacgagtactgc
atctgcgagatgccctgcaacatgacccgctacggcaaagagctctccatggtcaagatc
cccagcaaggcctcggccaaatacctggccaagaagtacaacaagtcggagcagtacatc
ggggagaacatcctggtgctggatatcttctttgaggccctgaactacgagacgatcgag
cagaagaaggcgtacgaggtggctggtttgctgggtgacattggaggccagatggggctg
ttcattggggccagcatcctcacagtgctggagctgtttgactacgcctacgaggtgata
aagcaccggctgtgccggcggggcaagtgccgcaagaaccacaagaggaacaacacagac
aagggcgttgcgctgagcatggacgacgtgaagcgccataatccctgtgaaagcatacgg
gggcacccagcaggcatgacttacgcagccaacatcctacctcaccacccggcccggggt
acctttgaggacttcacctgctaa

DBGET integrated database retrieval system