KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108372
Entry
102108372         CDS       T02921                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:phi03021]
    102108372 (AFF3)
Transcription machinery [BR:phi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102108372 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102108372
NCBI-ProteinID: XP_014105676
Position
Un
AA seq 1230 aa
MFIISIYSQIVYEPDRNVLRRKEWERRNQEAQQDNGTFNTSYSLFSEPYKTNKGDELSNR
IQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKTDEHLIADSRPPPPPPISSTT
SSTPASLAAQQSKSTTMGWQKAGHNAASDGQQRASKHGHRSLESHKGDFKLANQKSNLEK
LKRYASSPTSSSSSSNTAQQSSLRSTLGDNINRGQQPAKLSCSSEGGTQVQERPAKHGGG
HCVQNFPPSLASKPSLGQQKPTAYVRPMDGQDQAPDESPKLKLPAETTKSYRGVPSSKPD
SARTKSKIAKFSIPKQAEDSGTGDNSCIEEILREMTHSWPPPLSAIHTPGKAEQSKFPFP
NKESQQGSTGHSNTRKSDVEPKTPEKSATHTSMLEDDLKLSSDEEENDQQAAQRSALRVL
SDSSLVVPQSNARASGLSSKGSSSSSSSESETSSESDSESESSSSESDGSKPSHYSSPEP
EPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALEAHPYYGRVKAERQEGQKTPAEGPAEH
RSEESRTTAAAAAAAAAGDGPRPRTANKAPGSKGSRQKSPLAGDGGPPRRAAGKKAPRRA
ERNSAGDGPPCPSAEEPPRSHGFPESAAAEAPRARPGGGGCRAGHRREPRSAAAGEKRRA
RGPSKTAPKSKEFIETESSSSSSSSDSGSESEREERPLPKAPAAAGPEPRAAKDAGTGTA
SKPHGGCSAFGSINARTSSEIAKELEEQFYTLVPFGRNELLSPLKDSDEVKSLWVNIDLA
LLSRIPERLPEEPLAMSAGANQAASFPQGSSAEPPAEKGLPKSRRKRKCDNEEECRDIKK
THLERESSSRLAASAQSITTANHCNMNENSLAIPINKNEKMLRSPVSPLSDASKHKYSSD
DLTCSSRPNGSSLLPSISSSKKHKGEIQSQPHPGDFNKAVHINSENVLLCNKPQFQTEPW
SPLSTTPRDCRRTKLIFDDIPRNADYFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIE
CGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHSGPNATPEDKQLAALCYRCLALLYW
RMFRLKRDHAVKYSKALIEYFKNSSKAAQNPSPWGASGKSTGTPSPMSPSPSPVSSVGSQ
GSTGAPSPSPIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENRDFFNDLDALM
GPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3693 nt   +upstreamnt  +downstreamnt
atgttcataatttctatttactcacagattgtgtatgagccagatagaaacgtgctgcga
aggaaagaatgggaaaggagaaatcaggaggcccagcaggacaatggcacatttaacaca
agctattccctcttcagtgaaccctacaagactaacaagggggatgagctttccaatcgc
atccagaatacgttgggcaactatgatgaaatgaaagacttgttaactgaccggtcaaac
cagagccatctcgttggggttccaaaacctggggttcctcagacatctctccccaagact
gatgaacatcttatcgcagactcgagaccaccacctcctcctcctatttccagcactact
tcttccacaccagcatccctagctgcccagcagagcaaaagtaccacgatgggctggcag
aaggctgggcataatgccgcttcagatggccagcagagagcaagcaaacacggacaccgg
tcgctggagtcacacaagggtgacttcaaactggcgaaccaaaaatccaatttggagaaa
ctaaaacgctatgcatcgagtcccacctcctcctcctcctcctccaatactgcccagcaa
agctcgctgaggtccacattaggagacaacatcaacagaggccagcagccagcaaagctc
agttgtagctcagaaggaggaactcaagtccaagagaggccagcaaagcacggtgggggg
cactgtgtccaaaacttcccaccttctcttgcttcaaagcccagtctgggtcagcagaag
ccaacagcttatgtgaggccaatggatggtcaagaccaggctcctgatgaatctccaaag
ctgaagttaccagcagagacgaccaagtcatatcggggagtgccttccagcaagcctgat
tcagccaggaccaagtcaaagattgccaagttcagcattcctaagcaagcagaagacagt
ggaacaggagataacagctgcattgaagaaatattgcgggagatgacccattcatggcct
ccgccactgtccgctattcacacaccaggaaaggcagagcaaagcaagtttccctttcca
aacaaggagtcacaacagggatctacaggacacagcaatacgaggaaaagtgatgtagag
ccaaagaccccagagaaaagcgcaacccatacatcaatgctagaagatgacctcaagtta
agcagtgatgaggaggagaatgaccagcaggcagcacagagatctgctctccgcgttcta
tctgacagcagcctggtggtgccacagtccaatgcccgagcctcggggctttccagcaag
gggtcgagcagcagtagctccagtgaatccgagaccagctcagagtctgactcagagagt
gaaagcagctccagcgagagtgacggcagcaagccctcgcattactccagcccagagcct
gagccgccctcgtccaacaagtggcagctggacaagtggctgaacaaagttacccctcac
aaagcgcccatcctaacccaccacgatggcccggcgctggaagcccatccctactacggc
cgggtgaaggcagagcggcaggaaggacagaagaccccggctgagggcccggccgagcac
cgcagtgaggagagccgcaccaccgccgccgccgccgccgccgccgccgccggggacggg
ccgcggcctaggaccgccaacaaagctccaggcagcaagggcagtcgtcagaagtcaccc
ctcgctggcgacggcgggccgccgaggcgggcagcggggaaaaaggcaccgcgacgagcc
gagaggaactccgccggagacgggcccccctgccccagcgcagaggagcccccccggagc
cacggcttccctgaaagcgctgctgccgaggcgcccagggcccggcccggcggcggcggc
tgtagagcggggcaccgccgggagccccgctcagctgcagctggtgagaagcgtcgggcc
cgagggccgagcaaaacggcgcccaaatccaaggagttcatcgagaccgagtcttcatcc
tcatcatcctcctccgactcaggctctgagtcggagcgggaggagcgcccgctgcccaag
gcgccagcggcagccgggcctgagccgcgggctgccaaggacgcagggaccggcaccgcc
agcaaaccccacggcggctgcagtgcctttggctctattaatgccaggactagtagtgaa
atagcaaaggagctggaggaacagttttacaccctggttcctttcggtaggaatgagctc
ctgtctcctctgaaagacagtgatgaggtaaagtcgctgtgggtcaacattgacttggct
cttttgtccaggattccagagcgtttgcccgaagaaccgctggccatgagcgccggagca
aaccaggcggccagcttcccgcagggtagtagtgctgaaccccccgcagagaagggttta
ccgaaatctagaaggaaacgcaagtgtgacaatgaggaagagtgcagagacatcaagaag
actcacttagagcgagagagttcttcacgattagctgcctctgcccaaagcatcacaaca
gcaaatcactgcaatatgaatgaaaatagcttggcaataccaataaataaaaatgagaaa
atgcttcggtcacccgtctctcccctctctgatgcatcaaaacacaaatattccagcgat
gatttaacttgctccagcagacctaatggcagcagtctattaccttcaatctcctccagc
aaaaaacataagggtgaaatccagtcgcagccacatcccggagacttcaataaagcagtt
cacatcaattcagaaaatgttcttctctgcaataagccacagttccaaacagagccttgg
tcacctctgtccaccacacccagggactgcagaagaacaaagcttatcttcgatgatata
ccacgcaatgcagattactttatgcaggaagctaaacggaagaagcataaagcagatgca
atggtggagaagtttggaaaggcactgaattatgcagaagcagcactatcatttattgag
tgtggaaatgcaatggaacaaggcccaatggaatctaaatccccttataccatgtattca
gaaacagttgaactcatcaggtatgctgtgagactaaaaacccactcaggccccaacgcc
acgccagaagacaaacagctggcagcattatgttaccgctgcctggcccttctgtactgg
aggatgttccgactcaagagagaccacgcggtcaagtattctaaagcgcttatcgagtat
ttcaagaattcatcaaaagctgcccagaacccttctccttggggtgccagtggaaagagc
acaggaactccatcacctatgtccccaagcccttctccagtcagttccgtaggatcccag
gggagcacgggggccccttccccatctcctatcatcagcatcccacagcgcattcatcag
atggctgccaaccacgtcagcatcaccaacagcatcctgcacagctatgactactgggag
atggctgacaacctggccaaggaaaacagagatttttttaatgacttggatgcattgatg
ggacctatcaccttgcacagcagtatggagcatttagttcagtacactcaacaaggactt
cactgggtgcggaacagcgctcacttgtcataa

DBGET integrated database retrieval system