KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108500
Entry
102108500         CDS       T02921                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phi01009]
    102108500 (AKAP5)
Protein phosphatases and associated proteins [BR:phi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102108500 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 102108500
NCBI-ProteinID: XP_014105151
Position
Un
AA seq 507 aa
MVKAAKEIQMENPREAETPSTGATCSPPEEQAKKPSMLCFKKQKKSCKKGLTVKDTCEGA
SEEKSQCVSADQEEAKASNPSRSSKGTWAAIKNLAKPRRRQKSSSRKKVPSDSQVQLEAD
AEESCARDLPKKRASSGVKMPCVRFSRGKKKPSPSEAVEESEGSVQANEVMGVVNKASEE
PEDLAPTDKSESFSPVSAQDERDTVKQEQRRIKEDKDKMKEDQDTVKEDQDTGKEDQDTV
IEDHDTAKESDTSVGKSEPLTEPTCDAEEHSECTVQLEITHSETADETAQDKLQEGSLPQ
ITNDAEGREVAPEVPVPKDQSDNVPEITEWQEIPNICKEMPERDELEKSINFPKECKAEE
SVTDFSELASGGDAASVQEAVSVQEAVKANAGAGVSIVITITEAEDSDNTDSDQAYEPSP
VLRQKKQKGNKKLNRNADVGQKEGPEAGDGPQAEEKGLGDQGHRTGEQYELLLVETASSL
VKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaagaaattcaaatggagaacccaagagaggcagagactcccagc
acaggggccacatgttccccaccagaggaacaagcaaaaaaaccctctatgctctgtttt
aagaagcagaagaagtcctgtaagaaggggctgactgtgaaggatacgtgcgaaggagcc
tcagaagagaaaagccaatgtgtcagcgctgaccaagaggaggcaaaagcttccaatcca
tcacgatcctccaaaggaacttgggcagccatcaaaaaccttgccaaacctcggagaagg
cagaagtcctcctcacggaagaaggtgccctctgattcccaagtgcagctggaggcggat
gctgaggagagctgtgcgcgagacctcccaaagaaacgggcgagctctggggtgaagatg
ccctgtgtgagattctccagaggcaagaaaaaacccagcccctcagaagcagtggaggag
tcagagggcagtgttcaagcaaatgaagtgatgggtgttgtgaataaggctagtgaagag
ccagaggatttggccccgacggacaaatctgaatccttcagcccagtctctgcacaggat
gaacgggatacggtgaagcaggagcagcgtagaataaaagaggacaaggacaaaatgaaa
gaggatcaggatacagtgaaggaggaccaggatacggggaaggaggaccaggatacagtg
atagaggaccacgatacagcaaaggaaagtgacacctctgttgggaagagtgagcccttg
acagagcccacatgtgatgcagaggaacattcggagtgcactgttcagttggagataacc
cattcagagacagctgatgaaacagcccaggacaaactgcaggaagggagcctaccccaa
atcaccaacgatgcagagggtagggaagttgctcccgaagtgcctgttcctaaagaccaa
tctgacaatgtccctgaaatcacagagtggcaggaaatccctaatatctgcaaagagatg
cctgaaagggatgaactggaaaagagcataaattttcctaaggagtgcaaagccgaggag
tctgtaactgatttcagtgagttggcatctggaggtgatgcagcaagtgtgcaggaggca
gtgagtgtgcaggaggcagtgaaagcaaatgcaggtgctggtgtcagcatcgtcatcacc
atcaccgaagctgaggactccgacaacaccgactctgaccaggcttatgagccgtcccca
gttttgcgccaaaaaaagcaaaaagggaataaaaaattgaacaggaatgctgatgttggt
caaaaagagggccccgaggctggtgacggtccccaggcagaggagaaaggtctgggtgac
caggggcacagaactggggagcagtacgaattgctccttgtagaaaccgcctcttcactt
gtgaaggcggccattcagtcatccatagagcagctggtcaacgaaatggccctggaacag
aataaacacaacagctttctgtga

DBGET integrated database retrieval system