KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109550
Entry
102109550         CDS       T02921                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phi01002]
    102109550 (ADAMTS13)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102109550 (ADAMTS13)
Peptidases and inhibitors [BR:phi01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102109550 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 TSP1_CCN Reprolysin_3 Reprolysin_5 Reprolysin_2 Peptidase_M10 DUF3810 Fve
Other DBs
NCBI-GeneID: 102109550
NCBI-ProteinID: XP_014113499
Position
Un
AA seq 1400 aa
MTVSLALRALAVLPLGLCWLPEKFLGALDAEGVLSYFGTSSVPDVPEFVVAEPTCPCKEE
HFGLRPCRVQHCSIQAWGQLYAFEFLEEHALLSSSFLSSQVVNSSFVLLKRFPENCFAGG
KPLQPPGARSRVTYCGGQLQGVVTVGEGEEIHIRPVRSKDVALLRDLGFSSPHILFKSAA
REAKPARAGWAPPRLHKRAEAAVKHLELMVVAGPDVYLYHKEDTERYVLANLNIGAELLR
DASLGAHFRVHLMQMLVLREPEAEVNITANITSSLISVCEWSKKVNPQNDSDPQHADIVL
YITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIAHDG
EGNLCSSSGFIMGSAGNNNNNIDLTWSPCSREQFLTLVSTGQTSCLNDLPDMDGSIPGWK
PGLYYGADEQCKIAFGSVATACTFADSSVDICKVLSCHVQPADKSSCTRLLVPLLDGTEC
GFNKWCSKGQCSSLEDLNPMTVVHGHWSAWSPLSPCSRSCGGGVVLRQRFCNNPRPAFGG
QECHGTSMQAEMCNTQACLMTQQDFMAEQCVATNLKPLYLDVETPSFYTWTSAVGFAKGD
LLCKHMCRAVGKEFMVSRGDSFLDGTRCEQDGTEHHRDLHLCVMGRCRAFGCDGQMGSRK
AMDSCKVCGGDNSTCTKVSGSYTEGKAKEYVTFLSLPYNTTSVHVTNRRPLFTHLAVKVK
GEYVVAGKGRISLNVTYPSVLEDKQIKYQVFLTQDNLPSLEEIHVDGPTQEEIEIQVYRR
YTKEYGNATNPSITFSYFVPRENLTYLWIPQEGPCSVTCGEGVQPVAHVCFDQTKNEVTE
DQWCLELPQPLPEHRPCAMEPCLYRWKTSQRGECSAVCGTGVVRQNLTCVQSRDGLETVV
DDSLCPGEEKPLSFVPCVVNVCPLGWDKEEDAHLLQPLESLGHVQLENRTVYVWSPVAGE
CSVSCGRGKTHLHYVCVAFDTKEETQEENCQPVPKPESRVEVCDLNPCPPRWKVTPAGPC
SSSCGLGLAVQLVTCVQLLHGQEVLQEEHLCPVAEKPLTSVPCVIRACSYEWSFSEWSEC
STSCGNGIQTRQDFCLSSLTRKPVNPLFCRHFPKALVVRGCSTGPCPEQEGTLSPWPELQ
PVTPATQLTTAAAATEHRHKDLDVPLSAGPWEQTESGRGVCGNLFLSATGIINMTGTESR
DCMVAIGRPLREEILVTILESSLNCSAGEVLLFSGRMMWRTGCRKLPLSLINSRTNTLIV
KQRVVLPGNGVILQYNSRTATKKYYQDCDQQLFGPQGEIVTPVQLPDERQEVVCRTFITV
APRQRISIRALNTDLGLEGNQTHFNYILVRDVSTMKTVVFHGKQQFLWQSTGSQAEIEFH
ENVKDHRTHFWAEYHAIEPK
NT seq 4203 nt   +upstreamnt  +downstreamnt
atgaccgtcagcttggcgctgcgggcgctcgccgtgctcccgctggggctgtgctggctt
cctgagaaattcctcggtgctctggatgcggaaggtgttttgtcttactttggaaccagc
tcagtgcctgatgtacctgagtttgttgtggctgagccaacttgcccttgtaaagaagaa
cattttgggctgaggccctgtcgggtccagcattgctccatccaggcctggggccagctc
tatgcctttgaattcctagaggagcatgccctcctttcctcctcctttttgagcagccag
gtggtgaactcttcctttgttttactgaagagattcccagaaaactgctttgcaggtgga
aaacccctgcagcctcctggggccaggagcagagtcacttactgtggagggcagctgcaa
ggagtcgtcaccgtgggtgagggtgaggagattcacatcaggccagtcaggagcaaagat
gtagctctgctgagggaccttggcttctccagcccccacatcctcttcaaaagtgctgca
agagaggcaaagccagccagagcagggtgggctcctcctcgcctgcacaagagggctgag
gcagctgtcaaacatctggagctgatggtggtggcagggccagatgtttatttgtaccac
aaagaggacacggagcgatatgtcctggccaacctgaacattggagcagagctgctcaga
gatgcctcactgggggctcatttcagagttcacctcatgcaaatgctggttttgagagaa
cctgaggcagaggtgaacatcacagccaacatcacctcctccctcatcagtgtctgtgag
tggagcaagaaggtgaacccccagaatgactctgacccccagcatgctgacattgtcctc
tacatcaccaggtttgacctggagttgcctgatggaaacaaggagcttcgtggagtgact
cagttagggggagtctgctcctccttctggagctgtgtcattacccaggacactggcttt
gaccttggagtcaccatagcccatgagattgggcacagtcttggcattgcccacgatgga
gaggggaatctgtgcagcagcagtggttttatcatgggctcagcaggaaacaacaacaac
aacatcgacctcacctggtctccgtgcagtcgggagcagttcctgacccttgtcagtaca
ggccaaacaagctgcttgaatgacctgccggacatggatggcagcatcccggggtggaag
cctggcttgtactacggagcagatgagcaatgtaaaatagcctttgggagtgtggccaca
gcttgcaccttcgctgacagcagtgttgacatctgcaaagttctctcatgccatgtacaa
ccagcagacaaatccagctgtactcggcttctggttcccctcctggatggaactgagtgt
gggttcaacaagtggtgctccaagggtcagtgcagctctctggaggacctgaaccccatg
actgtggtccatgggcactggtctgcctggagccccctctccccctgctcccgcagctgc
ggcgggggagtggtgctgaggcagcgcttctgtaacaaccccaggcctgcttttgggggg
caggagtgccacggtaccagcatgcaagcagagatgtgcaatacacaggcctgtctgatg
acccagcaggacttcatggctgaacaatgtgtagcaacaaatttaaagccactgtacctt
gatgtagaaacaccatccttttatacctggacctctgctgttggctttgccaaaggggac
ctgctctgcaagcacatgtgcagggctgtgggcaaggagttcatggtgagccgcggggac
agtttcctggatggaaccaggtgtgagcaggatggcacggagcaccacagggatctccat
ctctgtgtgatggggagatgcagagcattcgggtgtgatggccagatgggctccaggaag
gccatggattcctgcaaggtctgtgggggtgataactccacttgcaccaaagtgagtgga
tcctacacagaagggaaagctaaagagtatgtgacatttctgtccctgccctacaacacc
acctcggtccatgtcaccaacaggaggcctctcttcacacacctggctgtgaaggttaaa
ggagagtatgtggtggctggaaaaggaagaatctcactgaatgtcacctacccgtcagtt
ctggaggacaagcagatcaaataccaagtgttcctcacccaggacaacctgccaagcctg
gaggaaatccacgtggatgggccaacacaggaagaaattgaaatacaggtctacaggagg
tacacaaaagaatatggcaatgccaccaacccatccatcaccttcagctactttgtcccc
agggagaacctgacctatctgtggattcctcaggagggcccatgttcagtgacctgtggg
gaaggggtgcagccagtggctcatgtgtgctttgatcagaccaagaatgaagtaacagag
gatcagtggtgtctggagctgccacagcccctcccagagcacaggccctgtgccatggag
ccgtgcctctacaggtggaagacgtctcagagaggtgaatgctctgctgtctgtgggact
ggagttgtcaggcagaacctgacctgtgtgcagtcccgtgatggcctggagactgtggtg
gatgacagcttgtgcccaggagaagaaaaacccctctcctttgtgccgtgtgtggtcaat
gtctgccctttgggctgggacaaagaggaagatgcacacttacttcagcctctggagtca
cttgggcatgtccagctggaaaatcggactgtgtatgtctggagccctgtagctggggag
tgttctgtctcctgtgggagaggtaagactcatctgcactatgtttgtgtggcttttgac
accaaagaagaaacccaggaggaaaactgtcagccagtgccaaagccagagagcagggtc
gaagtctgtgatctcaacccctgcccaccaaggtggaaggtaaccccagctgggccctgc
tcctccagctgtgggctgggcttagcagtgcagctggtcacctgtgtgcagctcctccat
ggccaggaggtcttgcaggaggaacatttgtgccctgtggcagagaagcccctcaccagt
gtcccctgtgtcatccgagcgtgctcttacgagtggagcttcagcgagtggtcagagtgt
tcaacatcctgtggaaatggcattcagaccaggcaggatttctgcctcagctctctgacc
cgcaagcccgtgaacccccttttctgccggcacttccccaaggccctcgtggtgcgtggc
tgctccacagggccctgtcctgagcaggaggggaccctgtccccttggccagagctgcag
ccagtgacaccagccacacagctgacaacagctgcagctgccacagagcacagacacaag
gacctggatgtccctctgtctgctgggccctgggagcagacagagtccggtcgaggtgtg
tgtggaaacctctttctcagtgccactggcatcatcaacatgacaggcacggagagcagg
gactgcatggtggccatcgggcgtcccctgagggaggagatcttggtcaccatcctggag
agttccctcaactgcagtgcaggtgaggtcctgctgttttctgggcgaatgatgtggcgg
acaggctgcaggaagctccctctgtcactgataaattccagaaccaacacactgattgtg
aaacagcgtgttgtgctgccaggaaatggggtcattctgcagtacaacagcagaactgca
accaaaaaatattaccaagactgtgaccagcagctgtttggcccccagggtgaaatagtg
actcctgtgcagttgcctgatgagaggcaggaggtcgtgtgtcggactttcatcacggtg
gctccgcggcagcgcatctccatccgtgccctcaacactgacctgggccttgagggcaac
cagacacacttcaactacatcctggtccgagatgtcagcaccatgaagacagtggtgttc
catgggaagcagcaattcctgtggcagtcaacaggaagccaagctgaaattgagttccat
gaaaatgttaaggatcacagaacccatttctgggctgaataccatgctattgagcccaaa
taa

DBGET integrated database retrieval system