KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109958Help
Entry
102109958         CDS       T02921                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00564  Glycerophospholipid metabolism
phi00565  Ether lipid metabolism
phi00590  Arachidonic acid metabolism
phi00591  Linoleic acid metabolism
phi00592  alpha-Linolenic acid metabolism
phi01100  Metabolic pathways
phi04010  MAPK signaling pathway
phi04217  Necroptosis
phi04270  Vascular smooth muscle contraction
phi04370  VEGF signaling pathway
phi04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102109958
   00565 Ether lipid metabolism
    102109958
   00590 Arachidonic acid metabolism
    102109958
   00591 Linoleic acid metabolism
    102109958
   00592 alpha-Linolenic acid metabolism
    102109958
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102109958
   04370 VEGF signaling pathway
    102109958
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102109958
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102109958
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102109958
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102109958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 102109958
NCBI-ProteinID: XP_014107349
Position
Un
AA seq 792 aa AA seqDB search
MRNLRKADLWSQTDCYVKLWLPTASCQEARTRTVHNCRNPIWNETFHFILQSEVKNILEL
TVCDEDTFTPDDCLMTVRFDVAKIQPGEKARLNFELNPENQEELEVEFLLENIPGVSEKI
ITNGVLVSREVSCLEVHVNETKMKSSYKRRDFTFTMKGSYEETQEISIGPQSRPGSSETT
RFHYIKHSQPRLLMTLPKERFFCCPGSGRKEMDVSSPLAVPLHSLDLGKKVTVMRGESYE
VSVNEENSCENLDLRLGFDLCAEEQDFICKRKKVVAAALKNVLHLDEDLQEDEVPVVAVV
TAAGGVRSMTAMFGSLLALQQLGVLDCVSYISGLSATTWTMSKLYEDANWSQKDLSGPVD
GIRKHVIKSKLHCFSLDHMKYYENKLCERKQEGHKVSFTDLWGLFIDCMLHHQESTHKLS
DQQLAVNRGQNPLPIYLSLNVKDDFSTLDFKEWVEFTPYEVGLLKYGAFVRSEDFGSEFF
MGRRMKKIPESHICFLEGTWSNIFSQSFMDAVYLSGHSEHFWHRWTRDTEHDIENHPALP
KKPHEQTTCLSIPKGCLSKTLREMMTGRPVVSTYHNFLKGLQLNNKYLENESFCMWKDTV
LDSSPNQLNDMSDYLKLIDTAFFINTSCPPILRPERKVDVILHLNYSGGSQTLPLDLFSE
YCLEHGIPFPSTELSQEDREHLKECYVFEDSLEAPILAYFPLVCDTFQKYKAPNVERSPA
EMEQGAVDVSNCAAPYGTGLLTYSEENFNKLLNLCSYNILNNKHLILQALRTAVERKKRL
KNYSSPNSSKHS
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatctccgcaaagcagatctgtggagccaaactgattgttatgtcaagctgtgg
ctgccaacagcttcatgtcaggaagcccggacaagaactgtacacaactgcagaaatccc
atctggaatgaaactttccacttcatcctacagagtgaagtaaagaacatcctggagctg
acagtctgtgatgaggatacttttacaccagatgactgtcttatgactgttcgctttgat
gtggctaaaatccagcctggagaaaaagctcgcctgaattttgagttgaatccagagaat
caggaagaactagaagtggaattcctactggaaaatataccaggagtatctgagaagata
attactaatggtgtactagtgtctcgtgaagtttcttgtttggaagtacatgtgaatgaa
acaaaaatgaagagttcttacaaaaggagagatttcacattcacaatgaaaggatcctat
gaagaaactcaagaaatttccatagggcctcaatccaggccaggaagcagtgaaaccacc
aggttccactacatcaaacacagtcaacccagactgctcatgactctaccaaaggagcgt
tttttctgttgtcctggctcaggtaggaaggaaatggatgtaagtagtcccctggctgtg
cctctccattctctggacttgggaaagaaagtgacagtgatgagaggggaatcttatgag
gtctctgtgaatgaggaaaatagttgtgagaatttagatttgcggttggggtttgatctg
tgcgcggaggagcaggatttcatctgtaaaaggaagaaggtggttgctgctgctctgaaa
aatgttcttcatctagatgaagacctgcaggaggatgaggtgccagtggtggcagtcgtg
actgcagcagggggagtgcggtccatgacagctatgtttggcagtcttctggctctccag
cagctgggtgttctggactgtgtgtcatacatcagtggtttatctgccacgacatggacc
atgtcaaagttatatgaagatgcaaattggtcacaaaaggatctcagtgggccagtagat
ggtatcaggaaacacgtgatcaagagcaagctgcactgtttctctttggatcatatgaaa
tactatgaaaataagctttgtgagagaaagcaagaggggcacaaggtgtcctttacagat
ttatggggactcttcattgattgtatgctacatcatcaggaaagtactcacaaactctca
gatcagcagctagcagtaaatcgggggcagaatccactccccatatacctgtccctcaat
gtcaaggatgacttcagcactttggattttaaagagtgggtggaattcacaccttacgag
gtgggtctcctgaaatatggggcctttgttcgttcagaggattttggcagtgagttcttc
atgggtcgccggatgaagaagatcccggaatcccacatctgcttcttggaaggcacatgg
agcaatatattttcccagagttttatggatgctgtctacctctcaggtcattcagaacac
ttctggcacagatggactcgagacactgagcatgacattgagaaccatcctgctctgccc
aagaagcctcatgaacagacaacctgcttatccattcccaaaggctgcctttccaaaact
cttcgagaaatgatgaccgggcggccagtggtttcaacttaccataatttcctcaagggc
ttgcagctaaataacaaatatttggagaatgagagcttttgtatgtggaaagacacagtg
ctggattcttctcccaaccagctgaatgacatgagtgactacctcaagctgatagataca
gctttcttcatcaacaccagctgcccacccattctgaggccagagagaaaagtggatgtc
attctccatttaaattacagtggaggatcacagactctgccactggacctgttctcagag
tactgtttggagcacgggatcccattccccagcacagagctgagccaggaagaccgggaa
cacctgaaggagtgctatgtgtttgaggacagcttagaggcacccatcttggcctatttt
ccactggtgtgtgataccttccaaaaatacaaggcaccgaatgtggagcgcagtcccgcg
gagatggagcagggagcagtggatgtgtccaactgtgctgctccctatggcaccggcctg
cttacctacagcgaagagaatttcaacaagctgcttaacctgtgcagctacaacatcctg
aataataaacacttaattctccaggctttgcgaactgccgtggaacgaaagaagcggctt
aaaaactattcatcgcctaattcaagtaaacactcttaa

DBGET integrated database retrieval system