KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109963Help
Entry
102109963         CDS       T02921                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00970  Aminoacyl-tRNA biosynthesis
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102109963 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phi03029]
    102109963 (GATC)
Enzymes [BR:phi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102109963 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102109963 (GATC)
Mitochondrial biogenesis [BR:phi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102109963 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 102109963
NCBI-ProteinID: XP_005524661
Position
Un
AA seq 179 aa AA seqDB search
MRALSVGWWLRAGRVPPRCGHRARAPPVPAPAPPPLARRASGNSRKAQEISQGSDSNQRV
PTSGLDLVPLKQKVSVEVLDHLEHLALVDFRDAEGVERLQKAIQFADQLHEVNTDGVEPM
DSVLEDRCLYLREDDVTEGNCTKELLENAREKVEEYFVAPPGNIPLPKLEERETFLQGS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctgtccgtcgggtggtggctccgcgccgggcgggtccccccgcgctgcggg
caccgggcacgggcaccgccggtaccggcaccggcaccgccgcccctcgccaggcgggcc
agcgggaacagcagaaaagcccaggaaatttcccaaggaagcgacagcaatcagcgggtc
ccgaccagtggcttggatttggtgcccttaaagcagaaagtgtcagtggaagtgctggac
cacttggagcacctggccctggtggatttcagggatgcggagggcgtggagcggctgcag
aaagcgatccagtttgctgatcagctccatgaagtaaacaccgacggcgtggaaccgatg
gattcagtgctggaggacaggtgtctgtatctcagagaagatgatgtgacagaaggcaac
tgcactaaagagctgctggaaaatgccagagagaaagtagaggagtattttgtagctcca
ccaggtaacatccctttaccaaagctggaagaacgagagacttttctgcagggctcttag

DBGET integrated database retrieval system