KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110114
Entry
102110114         CDS       T02921                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102110114 (RDH5)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102110114 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 102110114
NCBI-ProteinID: XP_005534034
Position
Un
AA seq 319 aa
MWLCVTLLAVAWAVAWLLRDRRTLPTVTDKHVFITGCDSGFGNLLARRLARRGYRVLAAC
LTPQGAQSLGDSAGGHLRTTLLDVTRSDSIQRAVEWVKEEVGEKGLFGLVNNAGIASPMG
PTEWMDMEDFRRVMAVNAFGAIEVTLRLLPLLKRARGRVVNTSSVLGRVSANGGGYCVSK
FCIEAFSDSLRRDMRHFGVKVSVVEPGFFRTNATELGPLEEALRQRWERLEPGTRSSYGE
HFLPQYLKVQRLLLSLLCDKDLAKVTWCMEHALRAQHPRSRYSAGWDAKLLWLPASYLPS
ALVDLALALLLPKPAQSVP
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggctgtgtgtgaccctgctggccgtggcctgggccgtggcctggctgctgcgggac
cgccggacgttgcccaccgtgacggacaaacacgttttcatcacgggctgcgacagcggc
ttcggcaacctgctggcccggcggctggcccggcgtggctaccgcgtgctggccgcctgc
ctgaccccgcagggagcccagagcctgggggacagcgccgggggacacctgcggaccacc
ctgctggacgtcacccgctccgacagcatccagagggccgtggagtgggtgaaggaggag
gtgggggagaaaggcctgttcgggctggtgaacaacgcgggcatcgccagccccatgggc
cccacggagtggatggacatggaggatttccggcgggtcatggccgtcaacgccttcggg
gccatcgaggtcaccctgcggctgctgccgctgctcaagcgcgcgcggggccgcgtggtc
aacacctccagcgtcctgggccgcgtctcggccaacggcggcggctactgcgtgtccaag
ttctgcatcgaggccttctcggacagcctcaggcgggacatgcggcactttggggtcaag
gtgagcgtggtggagccgggatttttccggaccaacgcgacggagctgggcccgctggag
gaggcgctgcggcagcgctgggagcgcctggagcccggcacgcgcagcagctacggagag
cacttcctgccccagtacctgaaggtgcagcggctgctgctgtccctgctgtgtgacaag
gacctggccaaggtcacctggtgcatggagcacgcgctgcgggcgcagcacccgcgcagc
cgctacagcgccggctgggacgccaaactgctctggctgccggcctcctacctgccctcg
gccctggtggacctggccctggccctgctcctgcccaaaccggcccagagcgtgccctga

DBGET integrated database retrieval system