KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110324Help
Entry
102110324         CDS       T02921                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00561  Glycerolipid metabolism
phi01100  Metabolic pathways
Module
phi_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102110324 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phi01002]
    102110324 (MGLL)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102110324 (MGLL)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S33
   102110324 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DLH Lipase_3 Thioesterase Peptidase_S9 Abhydrolase_2 PGAP1 Abhydrolase_5 DUF2436 FSH1 DUF1350 Ser_hydrolase LIDHydrolase LIP
Motif
Other DBs
NCBI-GeneID: 102110324
NCBI-ProteinID: XP_005522128
Position
Un
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQYLFCRYWKPAASPRALVFIAHGAG
EHCGRYDDLAQKLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKEHP
ELPVLILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLP
NLSLGSIDPSAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPIL
VLHGSSDKLCDIRGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVSTSVFTEILTWIGQ
KVSAAGETSHT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcttccagaatgccagaggaaagttcaccaaagcggagtcctcaa
aacatcccatacaaggatctgccccatatcatcaatgctgatgggcagtatctcttctgc
aggtattggaagccagcagcatctcccagggccctggtgttcattgcccatggcgctggg
gagcactgcggccgctacgacgacttggcccagaagctgacgggactcaacttgtttgtg
tttgcccatgaccatgttggccatgggcagagcgagggtgatcgtatggttgtgtcagat
ttccacgtcttcatcagagacagcttgcagcacattgatctgatgaagaaagagcaccct
gaactgcctgttctcatcctggggcactccatggggggagccatctccattctgacagct
agtgagcgacccagtgagttttcaggcatgctgttaatctctcctttagtggtagccagc
ccagaagtcgctactcccatcaaggtttttgcagcgaaagtgctcaactttgtgctccca
aacctatcactgggatcgatagatccaagtgcaatttcccggaacaagaaagagatggag
tcttacacatccgatcccttggtctaccacggtggcatgaaggtctccttcgtcatccaa
ctgatgaatgccattgccagaattgagcgagccctgcccaagctgactttgcccatcctg
gtgctacacggctcttctgacaagctctgcgatatcaggggctcttatttactgatggac
acagtgcagagccaggacaaaacgctcaaggtgtatgaggaagcctatcatgccctccac
aaagagctgcctgaggtctctacctctgtcttcacagaaatactgacatggattggccag
aaggtctcagcagctggggaaaccagccatacttaa

DBGET integrated database retrieval system