KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110818Help
Entry
102110818         CDS       T02921                                 

Gene name
FKBP14
Definition
(RefSeq) FK506 binding protein 14
  KO
K09577  FK506-binding protein 14 [EC:5.2.1.8]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:phi03110]
    102110818 (FKBP14)
Enzymes [BR:phi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102110818 (FKBP14)
Chaperones and folding catalysts [BR:phi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    102110818 (FKBP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 102110818
NCBI-ProteinID: XP_005519197
Position
Un
AA seq 218 aa AA seqDB search
MAGAMAAALLLCSALLCAALSCAGAALIPPAPDVKVEVLHKPFLCHRKTKWGDMMLVHYE
GYLERDGSMFHSTHKHNNGQPMWFTLGIREALKGWDRGLKDMCVGEKRKLTIPPALAYGK
EGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKQEVKIYLKKEFEKHGA
VVNDTQHDALVEDIFDKEDEDSDGFISAREFTYKHDEL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcgatggcggcggcgctgctgctgtgctccgccctgctgtgcgcggcgctg
agctgcgcgggcgcggcgctgatcccccccgctcccgacgtgaaggtggaggtgctgcac
aagcctttcctctgccacagaaagaccaagtggggggacatgatgctggttcactacgag
ggctacttggagagggatggctccatgtttcactcgactcacaagcataacaatggtcag
cctatgtggtttacacttggcataagggaagctctcaaaggctgggacagagggttgaag
gacatgtgtgtgggagagaaacggaagctaactattccaccagcccttgcttatggaaaa
gaagggaaaggaaaaattccacctgagagcacactgattttcaacattgaccttctagaa
attagaaatggaccaaggtctcatgagtcattccaagagatggatcttaatgatgactgg
aagctatccaagcaagaggtgaaaatttacttgaagaaagaatttgaaaagcatggagca
gtggtaaatgacacccagcacgatgctttggttgaagacatattcgataaagaggatgaa
gacagtgacgggtttatatctgcaagggaattcacatacaagcatgatgagctgtag

DBGET integrated database retrieval system