KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110973Help
Entry
102110973         CDS       T02921                                 

Gene name
MTMR3
Definition
(RefSeq) myotubularin related protein 3
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00562  Inositol phosphate metabolism
phi01100  Metabolic pathways
phi04070  Phosphatidylinositol signaling system
phi04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102110973 (MTMR3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102110973 (MTMR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102110973 (MTMR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phi01009]
    102110973 (MTMR3)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102110973 (MTMR3)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102110973 (MTMR3)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102110973 (MTMR3)
Protein phosphatases and associated proteins [BR:phi01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102110973 (MTMR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3 SlyX
Motif
Other DBs
NCBI-GeneID: 102110973
NCBI-ProteinID: XP_014109265
Position
Un
AA seq 1203 aa AA seqDB search
MDEETQHSLECIQANQIFPRKQLIREDENLQVPFIELHGESTEYVGRAEDAIIALSNYRL
HIKFKESVVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQDWLKRLNNAIRP
PSKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQEIIVPAWITDKELESVASFRSWKRIPAVVYRHQSNGAVISRCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSNSNKLMNGNCSRDLSNGGDLSDVEFDSSISNAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRKSFQ
SLRLLCTQMPDPGNWLSALESTKWLQHLSVLLKSALLVVHAVDRDQRPVLVHCSDGWDRT
PQIVALAKLLLDPYYRTTEGFQVLVETEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAANKAFKNLLYSSQSESVLYPVCHVRNLMLWSAVYLPCSSPSTPADDTCAPYPVPGSSP
EEQPLGRLPKTRSFDNLTTACDSSVPTTNRRSSDPSLNEKWQEHRRSLELSSLGPPGDDP
FEGDGLGRQGRAPVGAELSVAAGVAEGQMENILQEATKDDVGLEEHLRGGLEAAGKGDEV
GLDKEKRADSLCGEKAKADTGTVTNNPTANPHPASHGAAELKGQQDEHSDPSSALQKAPQ
GRGLQALPSEGSGNRDAPNTEEEGVGKGEGEAESPYGTAQASLAFPLTALLEERTSNIES
STETLTETEAKPELAPRALCHRPHPFDNSADELSRTLENRPEGECMIELQKLGSRAHRTS
GSSTTHLPMPSPCALPLADRKDELVYNGELELENKLVEKPAGFTAPKFPATNGHCVNGED
GRIKASLSRQVSAASCSSAQLHLRNLQQKWMCSQLGKQPAGSPDQPARSHLDDDGMPVYS
DVIQQRLRQIETGHQQEVETLKKQVQELKSRLESQLPNSSLRLNGDYGDEVTSIPDSESN
LDQNCLSRCSTEIFSEASWEQVDKQDTEVTRWLPDHLAAHCYGCDSAFWLASRKHHCRDT
DRVDQLWNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPGSSSLDLELDKPITA
TSN
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggagactcagcacagccttgaatgcatccaggctaatcagatttttcccagg
aagcagctgatccgagaggatgagaaccttcaggtgccgttcattgagctccacggtgag
agcacggagtacgtgggacgagcagaggatgccatcattgccctttccaactacaggctc
cacatcaaattcaaggaatctgttgtgaatgttccattgcagctcatcgagagtgtggag
tgccgggatatattccagcttcatttgacttgcaaggactgcaaggttataaggtgtcag
ttttccacctttgagcagtgtcaggactggctgaagaggctgaacaatgccatccgcccc
ccgtccaagatagaggacctgttctccttcgcctaccacgcctggtgcatggaggtttac
gccagtgaaaaggagcagcacggggacttgtgtcggccaggagaacatgtaacttccagg
tttaagaacgaagtggagcggatggggtttgatatgaacaatgcctggaggatttccaac
atcaatgagaagtacaagctgtgtggcagttacccccaggagatcatcgttcccgcctgg
atcacggacaaggagctggagagcgtggccagcttccgctcctggaagcgcatccctgcc
gtggtgtacaggcaccagagcaatggggcagtgatctcccgctgcggccagcccgaggtg
agctggtggggctggaggaacgccgacgatgagcacctggtccagtccgtagccaaagcc
tgtgcctcagactccaggtccaacagtaacaagttaatgaatgggaattgttccagagat
ttgtccaatggaggggacctctctgatgtggaatttgactcctccatctccaatgcctca
ggagcagagagtttggcaatccagcctcagaagcttttgatcctggatgcgcgatcttac
gcagcagccgtggccaacagagccaaggggggtggctgtgagtgcccagagtattacccc
aactgtgaagtggtgttcatggggatggcaaacatccattccatccgcaagagcttccag
tcgctgcgcctgctctgcacacaaatgccagatccgggaaattggctgtcagctctggag
agcaccaagtggctgcagcacctgtcagtgctcctgaaatccgcgctgctcgtggtgcac
gccgtggaccgggaccagcggccggtgctggttcactgctccgacggctgggaccgcacg
ccccagatcgtggccctggccaaactcctgctggacccctactacaggaccacagagggt
ttccaggtgctagtggagacggagtggctggattttggccacaagtttgcagatcgctgt
ggccacggggagaattcagacgacctcaatgagcgctgcccggtgtttctgcagtggctg
gactgtgtccatcagctccagaggcagttcccctgctccttcgagtttaacgaagcattc
cttgtgaagttggtgcagcacacctactcctgcctctttggaacattcctgtgcaacaat
gcgaaagagagaggagagaaacacactcaggaacggacctgctccgtctggtcattgctg
cgggcagcaaacaaagccttcaaaaacctgctctactcctcccagtcggaatctgtgctg
tatcccgtgtgccatgtgcggaacttgatgctctggagcgctgtttacctgccctgctcc
tccccctccacgcccgccgacgacacctgtgccccgtaccctgtgccaggctctagcccc
gaagagcagcctctgggcaggctaccaaagacaagatccttcgacaatctgacgacagcc
tgtgacagcagcgtgcctacaaccaaccgccggagcagcgaccccagcctcaacgagaag
tggcaggagcaccgccgctccctggagctcagcagcctgggccctcctggggacgacccc
ttcgagggggacgggctgggcaggcagggcagggcccccgtgggggcagagctctctgtg
gcagccggggtggcagagggacaaatggagaacattctgcaggaggccactaaagatgat
gttgggctggaggagcacttgaggggtggcctggaggcagcagggaaaggggatgaggtt
ggcctggataaggagaagagagctgacagtctgtgtggggaaaaggccaaggcggataca
ggtaccgtaacgaacaatcccacagccaacccccacccggcctcgcacggtgctgcagag
ctgaaagggcagcaggacgagcacagcgaccccagcagtgctctccagaaggcgcctcag
gggagaggcctgcaggcccttccttccgagggctccggaaacagagacgctccaaacacg
gaggaggaaggtgttgggaaaggtgaaggagaagcagagagcccgtacggcacggcccag
gccagccttgccttccctctgacagccctgctggaggaaaggacatccaacattgaaagc
tccacggaaaccttaacggagactgaagcaaagcccgaactcgcgcccagggctctgtgc
cacagacctcaccccttcgacaacagcgcagacgagctgtcccgaactctggagaacagg
ccggagggggagtgcatgatagagctccaaaaactgggatcaagagcgcacaggacttct
ggtagcagcaccacacacctcccgatgccttccccttgtgccttgcctctagcagaccgc
aaagatgagctggtgtataacggggagctggagctggagaacaaactggtggagaaaccc
gcgggattcacggccccgaaattccccgccaccaacggacactgcgtcaacggcgaggac
gggcggatcaaggcctcgctgagccggcaggtgtccgcggccagctgcagctctgctcag
ctccacctgaggaacttgcagcagaaatggatgtgcagccagctcgggaagcagccggcc
ggcagcccggaccagccggcccgcagccacctggacgacgacgggatgcccgtctacagc
gacgtcatccagcagcgcctgcgccagatcgagacgggccatcagcaggaggtggagacc
ctcaagaagcaggtgcaggagctgaagagccgcctggagagccagctccccaacagctcc
ctgcgcctcaacggcgactacggggacgaagtgacgtctattcccgactcggaaagcaat
ctggatcagaactgcttgtctcgctgcagcacagagattttctctgaagccagctgggaa
caggtggataaacaggatacagaggtgacgcggtggctcccggatcacctggccgcgcac
tgctacggctgcgacagcgccttctggctcgccagtcggaaacaccactgcagggacact
gaccgagttgatcagctctggaattgtggcaacgtgttctgctccagttgctgtaaccag
aaggtgcccgttcccagccagcagctcttcgagcccagcagagtctgcaaatcctgctac
agcagcctccaccccggcagctccagcctggacctcgaactggacaagcccatcactgcc
acatccaactga

DBGET integrated database retrieval system