KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112757Help
Entry
102112757         CDS       T02921                                 

Gene name
PAH
Definition
(RefSeq) phenylalanine hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00360  Phenylalanine metabolism
phi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
phi00790  Folate biosynthesis
phi01100  Metabolic pathways
phi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    102112757 (PAH)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    102112757 (PAH)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102112757 (PAH)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     102112757 (PAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_4
Motif
Other DBs
NCBI-GeneID: 102112757
NCBI-ProteinID: XP_005527935
Position
Un
AA seq 446 aa AA seqDB search
MDSQHCKMNGDSFLESRYIEDSPNKNGVISLIFSLKEEVGALAKVLRTFEEKGINLTHIE
SRPSRLNKDEYEFFINLEGKNVPALDKIIKSLRSDIGATVHELSRTKKKDTVPWFPRSIQ
ELDRFANQILSYGAELDADHPGFKDPVYRARRKEFADIAYNYRHGQPIPRVTYTEEEKKT
WGTVFRELKSLYPTHACYEHNHVFPLLEKYCGYREDNIPQLEDVSNFLQSCTGFRLRPVA
GLLSSRDFLAGLAFRVFHSTQYIRHGSKPMYTPEPDICHELLGHVPLFADPSFAQFSQEI
GLASLGAPDDFIEKLATVYWFTVEFGLCKEGDSLKAYGAGLLSSFGELQYCLSSKPEIQP
LVLEKTSVQKYPVTEFQPIYYVAESFKDAKEKLRKFAQTIPRPFSVRYNPYTQRIEVLDN
AKQLKNLADTISSEIGILCNALQKIK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggactcacagcactgcaaaatgaatggtgactctttcctggaatctaggtacattgaa
gactcccccaataaaaatggtgtgatttctttgattttctctctgaaagaagaagttggg
gcactggctaaagtcctgcgcacatttgaggaaaaaggtataaacttgacccacattgag
tcccgaccttcccgtctcaacaaagatgagtatgaattcttcattaacttggaaggcaag
aatgtcccagcactggacaagatcatcaagtccttgagaagtgatattggagcaacagtc
catgagctttcacgaacaaagaagaaggacactgtaccatggttcccaagaagtatccag
gagctggacagatttgccaatcagatcctaagctatggagcagaactggatgctgatcat
cctgggttcaaagatcccgtgtaccgggcccggaggaaggagtttgcagatatcgcctac
aactacagacatggccaacctattcctcgtgtcacctatacagaagaagaaaagaaaact
tggggcactgtcttcagggagctgaagagtctgtatccaactcatgcttgctatgaacac
aaccacgtgttcccactgctggagaagtactgtggctacagggaggacaatattccccag
cttgaagatgtttcaaatttcttgcagagctgcactggctttcggctgcgccctgttgca
ggcttgctctcctctcgggatttcctggctgggctggcgttccgagtgttccactctacg
cagtacatccgccacggctccaagcccatgtacaccccagagcctgatatttgtcatgag
ctgctaggacacgtgcctctttttgctgatcccagttttgctcagttctcccaggaaatt
ggactggcatctctgggtgctccagatgatttcatcgagaaacttgctacggtttattgg
tttacagtggagtttggactatgtaaggaaggagattctctcaaggcatatggtgcaggg
cttctgtcttcatttggggagctgcagtattgtttatcaagtaagcctgagattcagcct
cttgtcctggagaagacttctgtgcagaagtaccctgttactgagttccagcctatctac
tatgttgctgaaagttttaaagatgcaaaagaaaaactaaggaaatttgctcaaacaatc
cctcgtcctttctctgttcgctataatccctacacacagaggattgaagtcttggacaat
gcaaagcagctgaagaacttagctgacaccatcagtagtgagattgggatcctttgcaat
gccctccagaagatcaaatga

DBGET integrated database retrieval system