KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113858Help
Entry
102113858         CDS       T02921                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00600  Sphingolipid metabolism
phi01100  Metabolic pathways
phi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102113858 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102113858 (GALC)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     102113858 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 102113858
NCBI-ProteinID: XP_014105462
Position
Un
AA seq 674 aa AA seqDB search
MDCAALLWGTILLACSCGPAPPRVGAAPLLAATYVLDDANGLGREFDGIGAVSGGGATSR
LLVNYQEPYRSQILDYLFKPNFGASLHILKVEIGGDAQSTDGTEPSHMHYENDENYFRGY
EWWLMKEAKKRNPQIKLIGLPWAFPGWIGKGENWPYDYPDITAYYIVSWILGAKQYHDLD
IDYIGIWNERAFNSKYIKLLRYTLDKHGLEQVRIIASDRLWEPISFVMMIDSELHGVVDV
IGAHYPGTKTVQNAILTGKKLWSSEDYSTFNDDVGAGCWARILNQNYVNGNMTSTIAWNL
VASYYEELPFGRCGLMTAQEPWSGHYKVESPIWITAHTTQFTQPGWSYLQVDGHLEGGGS
FVALTDGLGNLTIIIETMSHNHSKCIRPPLPNFNVIPQRATFYLRGSFYMVEILQVWHSR
LDFESGHSSLFQKLRPVKVWKGRFSLDLNVDEVYTLTTLKTGRKYSCPEPPPPQPFPSNY
KDDFNIRNPPFSEAPNFADQTGVFEYFVNASDPGDHVFTLRQVVVQRPITWVSDADQTIS
VIGNFKWVNMTVTCDIYIEKPRDGGVFIAGRVDNGGIYVRRTKGVFFWVFADGTYRVTGD
LAGEEILMKGLAGVRDNAWHTLTLNIQGNSASGLLNGYPLWENVTISKPQNGWAALGTRS
FELAQFDNFQVEAC
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggactgcgcggctctgctctggggcacgattctgcttgcctgcagctgcggcccggcc
ccccccagggtcggtgctgctccgctcttggcggccacctacgtgctggacgatgccaac
gggctgggcagggagttcgacgggatcggggcagtcagcggcggcggggccacatctaga
ctcctggtgaactaccaagaaccatatcgctcccagattttagattacctgttcaagcca
aattttggtgcttctttacatattctcaaggtagagattggaggtgatgcccagtcaaca
gatggtacggaaccctcccatatgcactatgaaaatgatgagaactacttccggggctat
gaatggtggctgatgaaagaagctaaaaagagaaacccccaaattaaactgattggatta
ccttgggcatttccaggatggatagggaagggggaaaattggccctatgactatccagat
atcactgcttactatattgtttcttggatattaggagcaaaacagtatcatgatttggac
attgattatattgggatatggaatgaaagggcatttaatagcaaatacattaagctgttg
aggtacacattggataagcatggtctggagcaggtgaggatcatagccagcgatagactg
tgggagcccatttcctttgtcatgatgattgactctgagctccacggagtggtcgatgtg
attggggctcactatcctgggacaaaaacagtgcaaaatgctatattaactgggaagaaa
ctgtggtcatcagaagattacagtactttcaatgatgatgttggtgcaggatgctgggct
cggatcctgaaccaaaattacgtgaatggaaacatgacctcaacaatcgcatggaatttg
gtggccagttattatgaggagttgccctttggtcgatgtggattaatgacagcacaggag
ccatggagtggccactataaagttgaatctcctatctggattacagcacacaccacacaa
tttactcaaccaggctggtcatacttgcaagtggatggacacttagaaggaggtggcagc
tttgtagctctgacagatggcctagggaaccttaccatcataattgaaactatgagtcat
aatcactctaaatgtatcaggcctccattgccaaatttcaatgtcatacctcagagagca
actttctacctcagagggtcattttatatggtggaaatccttcaagtgtggcactctaga
cttgattttgaatctggacactccagtcttttccagaaactccgtcctgtaaaggtatgg
aagggaagattttctttagatctaaatgtggatgaagtctacactttaaccacactcaag
acaggacggaaatatagttgcccagagccgcctcctcctcagccctttccttcaaattac
aaagatgatttcaatatacgtaatccacctttcagtgaagccccaaattttgcagatcag
acaggtgtatttgaatactttgtaaatgcttctgaccctggagatcatgtgttcacactc
cgccaggtggtggttcagcggcccatcacttgggtttctgatgcagaccagaccatcagt
gtcataggaaattttaagtgggtaaacatgacagtcacatgtgacatctacatagaaaaa
cctcgtgatggaggcgtttttattgcaggaagagttgacaatggtgggatatatgtgcga
cgtaccaaaggagttttcttctgggtttttgcagatggcacctacagagtcactggtgac
ctagctggagaggaaatattaatgaaaggacttgctggtgtccgggataatgcatggcac
acactcactctcaacattcagggcaactccgcctcaggactgttaaatggttatccgctc
tgggagaatgtcaccatttctaaaccgcagaacggctgggctgctctcggaactcgctcg
tttgagttggcacagtttgacaacttccaggttgaagcttgctga

DBGET integrated database retrieval system