KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102113859Help
Entry
102113859         CDS       T02921                                 

Gene name
ANXA11
Definition
(RefSeq) annexin A11
  KO
K17095  annexin A7/11
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102113859 (ANXA11)
  Exosomal proteins of other body fluids (saliva and urine)
   102113859 (ANXA11)
  Exosomal proteins of colorectal cancer cells
   102113859 (ANXA11)
  Exosomal proteins of bladder cancer cells
   102113859 (ANXA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 102113859
NCBI-ProteinID: XP_014105974
Position
Un
AA seq 504 aa AA seqDB search
MQKIFAMSYPGYPPAGGYPPAAPGSSPWGGAAYPPSNPPPIGLENVAGYANQFNPSHMAG
MASNLAGTFGGANVPQNMYPSTPGGYPPVPPGGFGQPPPGQQPSYGGYAPPGGNPPSGMP
SYPGYGGGPVPGQPTPPPAQQPMNYPGFPAAHPGQQPMPNYPAGPAVNPSMPSYSGTTGP
AVTPLTHGNRGTITDAPGFDPLKDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQIILS
FKTAYGKDLIKDLKSELSGNFEKTILAMMKTPVMFDAYEIKEAIKGVGTDENCLIEILAS
RSNEHIQELNRVYKAEYKKTLEEAIKSDTSGHFQRLLISLAQGNRDESTNVDMSVVQRDV
QELYAAGENRLGTDESKFNAILCARSRAHLRAVFSEYQRMCNRDIESSICREMSGDLERG
MLAVVKCLKNTPAFFAERLYKAMKGAGTKDRTLIRIMVSRSEVDLLDIRAEYKRMYGRSL
YSDITGDTSGDYRKILLKLCGGND
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatctttgcaatgagttacccgggctatcccccagcgggtggatatccacca
gctgctccaggtagcagtccttggggtggtgctgcctatccaccttcaaatccacctcca
attggtctggaaaatgtggctggctatgccaaccagttcaatcccagccacatggctgga
atggcatccaacctggcagggacctttggaggggcaaatgtaccacaaaacatgtatcct
tccacacctgggggttatccacctgttcctccaggtggctttgggcaacccccgccagga
cagcagccctcgtacggagggtatgctccccctggaggaaatccaccatccggaatgccc
tcttatccagggtatggaggcggccctgtgccaggccagcccacaccaccacctgctcag
cagcctatgaactatccaggatttccagcagctcacccagggcagcagcccatgccaaat
tacccagcaggtccagctgtgaacccatctatgccctcttactcaggaactacagggcct
gcagtcactcctctaacacatggaaaccgaggtaccatcactgatgcaccaggttttgac
cctctgaaggatgcagaagtcttaaggaaggccatgaaaggatttggaaccgatgagcag
gccatcatcgattgtcttggaagtcgttcaaacaagcaacggcagcagataatcctgtcc
ttcaaaacagcttatggaaaggatttgatcaaggatctcaagtctgagctatcaggtaac
tttgagaagacaatcttggcaatgatgaagacacctgtcatgtttgatgcttatgaaatc
aaggaagctataaagggcgttggcacagatgaaaactgtctcattgaaatcttagcttcc
cgcagtaatgagcatattcaggaacttaacagggtctataaagcagaatataagaaaact
ctggaggaagcaataaaaagtgacacatctggacactttcagagacttttaatatcactt
gctcagggaaacagagatgaaagtacaaatgtcgacatgtctgttgtccaaagagatgta
caggagttgtatgcagctggagagaaccgtctaggaactgacgaatccaaattcaatgcc
attctgtgtgcaagaagcagggcccaccttagagcagtcttcagcgagtaccagaggatg
tgtaaccgggacatcgaaagcagcatatgtcgtgaaatgtctggagacctggagaggggc
atgctggcagtagttaagtgtctcaagaacacaccagctttttttgcagagagattatat
aaagcaatgaagggagcggggacaaaggacaggacgctgatccggatcatggtatcgcgc
agcgaggttgacttgctggacatacgtgcagagtacaagcggatgtatggcagatctctc
tactcagatatcactggtgatacttcaggagactaccggaaaatcctactcaagttgtgt
ggtggaaatgactaa

DBGET integrated database retrieval system