KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114231Help
Entry
102114231         CDS       T02921                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00480  Glutathione metabolism
phi00590  Arachidonic acid metabolism
phi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102114231 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102114231 (GPX1)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102114231 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 102114231
NCBI-ProteinID: XP_005522327
Position
Un
AA seq 198 aa AA seqDB search
MAAAAAAAGGAAGLAGLAARPLGAAEPMSLGSLRGKVLLVVNVASLUGTTRRDFLQLNEL
QQRYGPRGLQVLGFPCNQFGHQENCTNNEILPMLEYVRPGNGFKPNFIMFEKCEVNGKDE
HPLFTFLKEALPFPHDDPSSLMTNPQYIIWSPVRRNDIAWNFEKFLIGPDGVPFKRYSRS
FETIKIQDDIELLLQKVA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcggcggcggcggcgggcggtgcggcggggctggcggggctggcggcgcgg
cccctgggcgcggcggagccgatgtcgctcggctcgctgcggggcaaggtgctgctggtg
gtcaatgtggcgtcgctctgaggcacgaccaggcgcgacttcctgcagctcaacgagctg
cagcagcgctacggcccccgcgggctccaggtcctcggcttcccctgcaaccagttcggt
caccaggaaaactgcaccaacaatgagattcttcccatgctcgagtacgttcgtcctggc
aacgggttcaagccaaatttcatcatgttcgagaagtgcgaggtgaacgggaaggacgag
caccctctcttcactttcctgaaagaggcgctgcccttcccgcacgacgacccctcctcg
ctgatgaccaacccgcagtacatcatctggtccccggtccgccgcaacgacatcgcctgg
aacttcgagaagttcctcattggccccgacggcgtgcccttcaaacgctacagccggagt
ttcgaaaccatcaagatccaggatgatattgagttgcttctgcagaaggttgcctag

DBGET integrated database retrieval system