KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114405Help
Entry
102114405         CDS       T02921                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
KEGG Orthology (KO) [BR:phi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102114405 (THNSL2)
Enzymes [BR:phi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     102114405 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 102114405
NCBI-ProteinID: XP_014115528
Position
Un
AA seq 489 aa AA seqDB search
MEYVSTRGGVRAVDFEGALFSGYAPDGGLFMPQRIPSLDRDTLQRWSSLSYPELVKELCS
LFVPAKLVPRDALNDLINRAFSRFRHKNVVHLSRLKDGLNILELWHGVTYAFKDLSLSCT
GQFLQYFLEKKQKHVNILVGTSGDTGSSAIESVRGQKNVDIFVLLPKGLCTQIQELQMTT
VIEDNVHVFTAHGNSDEIDEPIKELFADVNFAGKYNLMSLNSINWSRIMVQIAHYFYAYF
QCVPSLDTTPLPVVEIVVPTGGGGNITAGCIAQKMGLPIQLITVVNSNDIIHRTVQHGDF
SLAESVKATLASAMDIQEPYNVERILWLLSGSDSCLIKTLMEQFNIAKRLKLPEDLHRKL
SETLGSCSASDQDIVGAMRRCWEENQYLLCPHSAVAAHYHYSQPHSIPRCCLAPASAAKF
QNAVLQAGLVPQIPSEITALMAMESRSTPLERGQDWAQVLRGRIEAVAQRWEAQAGQSAP
QGRGGSLGR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgtcagcacacggggaggcgtgagggccgtggacttcgagggagcccttttc
tctggctatgcacccgatgggggcctcttcatgccccagcgcatcccctcgctggacagg
gacactctgcaaaggtggagcagcctctcctaccctgagctggtgaaggagttgtgctcc
ctcttcgtcccggccaagctggtcccgcgggacgcgctcaatgacctgatcaacagggcc
ttcagcagattcagacacaagaatgtcgtgcatctgtccaggctgaaagatgggctgaac
attttggagctctggcatggtgttacgtatgcatttaaggacctgtccttgtcctgcaca
ggacagtttttacagtattttttggagaagaagcagaagcatgtcaatattctggtgggg
acttcaggggacacgggcagctcggccattgagagtgtgagagggcagaagaacgtggac
atctttgttctgctgcccaagggactctgcacccagatacaggaacttcagatgaccact
gtcattgaagacaacgtccatgtctttactgctcatgggaacagtgatgaaatagatgag
ccaatcaaggaactgtttgctgatgtcaattttgctggaaaatacaacttgatgagcttg
aattccatcaattggtccaggattatggtgcagattgctcactacttctatgcttacttt
cagtgtgtcccatccctggataccaccccattgccagtggtggaaattgttgtgcccacg
ggaggaggaggaaatatcacagctggctgtattgcccagaaaatgggtctcccaattcaa
cttattactgtggtgaacagcaatgacatcattcataggactgttcaacatggagatttc
tcactggcagagagcgtgaaggctacgttagcatcagccatggatatccaagagccttac
aatgtggagaggatcctctggctgctctcaggctctgacagctgcctgataaaaactctg
atggagcaattcaacatcgcaaaaaggctgaagctgccagaggatttgcacagaaagctc
tccgagaccctgggatcatgctcagcttctgaccaggacattgtgggcgccatgcggcgc
tgctgggaggagaaccagtacctgctgtgcccccactctgccgtggctgctcactaccac
tactcacagccacacagcatcccccggtgttgcttggctccagcctctgcagccaaattt
cagaatgccgttctccaagctggcctggttccccagatcccctctgaaatcactgccctg
atggcaatggagagcaggtccactcccctggagcggggacaggactgggcacaggtgctc
cggggccggattgaagctgtggcacagcggtgggaggcacaggcgggtcagtctgccccc
cagggcagggggggatcactgggcaggtag

DBGET integrated database retrieval system