KEGG   Pelagibacterium halotolerans: KKY_1454Help
Entry
KKY_1454          CDS       T01645                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00220  Arginine biosynthesis
phl00330  Arginine and proline metabolism
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01130  Biosynthesis of antibiotics
phl01230  Biosynthesis of amino acids
Module
phl_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KKY_1454
   00330 Arginine and proline metabolism
    KKY_1454
Enzymes [BR:phl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KKY_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEQ51474
UniProt: G4R9R7
Position
complement(1436800..1437726)
Genome map
AA seq 308 aa AA seqDB search
MRGPEPRTITLIGAPVEDGAGRQGCSMGPKALRIAGLAEALSGLGHTVIDRGDVLPEGNE
FALEGLAHNVVEVTGFARALADAGESALADGTAVYLGGDHALSFGSVAAALRHADRVGKK
LHVLWLDAHADFNTPQTSTSGNMHGMPAAFFCGEAGFDGMLECPTMPASRYHLVGARSID
PAEVDLLAARGADVNDMAEIDEHGIGAIVRRILKEVEADDALLHVSLDVDFIEPDLAPGV
GTTVPGGATVREAHLAMEMVGRCGRLVSLDLVELNPFLDDRGKSARLMVELAASAFGRRI
FDRPTQPA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggacccgagccaagaaccatcaccctgattggagcgcccgtcgaagacggcgcg
gggcggcaggggtgttcgatgggccctaaagccctgcggatcgccgggctggcggaggcc
ttgtcggggcttgggcatacggtgatcgatcgcggcgatgtcttgccggaaggcaatgaa
ttcgcgctcgaagggctggcgcataatgtcgttgaggtgaccgggtttgcccgggcgctg
gccgatgcgggcgagagtgctctagcggacggcacggctgtttatctgggtggggaccat
gcgctctcgttcggttctgtggcggccgccttgcggcatgcggatcgggtgggcaagaag
ctgcacgtgctgtggctggatgcgcatgccgatttcaatacgccgcagacttcgacgtcg
gggaacatgcatggcatgccggcggcgtttttttgcggcgaggccggtttcgacggtatg
ctcgagtgtccgacgatgccggcaagccgctatcatctggtcggcgctcgctctatcgat
ccggcggaagtggacctgctggcggcgcggggcgccgacgtcaacgacatggccgagatc
gacgagcacgggatcggcgcaatcgtgcggcgcatcctcaaggaagtcgaggcggatgac
gcgcttttgcatgtgagcctcgatgtcgatttcatcgagcccgatctggcgcccggtgtg
gggaccacggtgccgggcggcgcgacggtgcgcgaggcgcatctggcaatggaaatggtg
ggacggtgcgggcggcttgtcagtctcgacctggtcgagctcaacccgtttctcgacgat
cggggcaagagcgcccgcctgatggtcgaactggcagcgagcgcctttggacgccgtatt
ttcgaccgcccgacacaacctgcataa

DBGET integrated database retrieval system