KEGG   Pelagibacterium halotolerans: KKY_2121Help
Entry
KKY_2121          CDS       T01645                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00260  Glycine, serine and threonine metabolism
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01120  Microbial metabolism in diverse environments
phl01130  Biosynthesis of antibiotics
phl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KKY_2121
Enzymes [BR:phl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KKY_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEQ52130
UniProt: G4RGU1
Position
complement(2107560..2108582)
Genome map
AA seq 340 aa AA seqDB search
MTTRRYDFRSDTVTRPDAGMRAAMAEAPVGDDVYGEDETVAALEARVAELTGKAMGIFVP
SGTQSNLIALMSHCGRGDEFIAGQDAHAYKYEAGGAAVLGSIQPQPIENAPDGSLPLDKI
AAAVKLDDIHFARSRLLALENTIGGKVLPQSYVGDAVALARRHGLATHLDGARIVNAAVA
SNRSVRALAEGFDSVSVCLSKGLGAPVGSVLVGDEDFIGKARRLRKMLGGGMRQAGIIAA
AGLYALEHNVARLADDHARARRLAEGLARYDALAVDMPQTNIFFLRADSAVAEGFADHMA
AAGILVSGRYGQQRWVTHKDIGDEAIEAALDAAEKFFSGR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagacgctatgatttccgctccgacacagtgacgcggcccgatgcgggcatg
cgcgccgcaatggccgaggcgccggtgggagacgatgtttacggcgaagacgaaaccgtg
gccgcactcgaagcccgggtcgcggaattgaccggaaaggcgatgggcatcttcgtgccc
tcggggacgcaatcgaacctgatcgcattgatgagccattgcgggcggggcgacgagttc
atcgccggccaggacgcccacgcctataaatacgaggctggcggggccgcggttctgggg
tcgatccagccgcagccgatcgagaatgcgcccgacggctcgctgccgctcgacaagatc
gcggcggcggtcaagctcgatgatatccatttcgcccgctcccggcttctggccctggaa
aataccatcggcggcaaggttctgccgcagagttatgtgggcgatgcagtggcgctggcg
cgccggcacgggctggccacgcatctggatggggcccgaatcgtcaacgcggcggtggct
tcgaaccggagcgtgagggcgttggccgaagggttcgacagtgtctcggtgtgtctgtcc
aagggcctgggcgccccggtgggctcggtgctggtcggggacgaggatttcatcggcaag
gcccgccggctgcgcaagatgctgggtggcggcatgcggcaggccggcattatcgcggcg
gcgggcctttatgcgctcgagcacaatgtggcgcggctggccgatgaccatgcgcgggcc
cggcggctggcggaagggctcgcgcgatacgacgcgcttgccgtggacatgccgcagacc
aatatctttttcctgcgggccgacagcgcggtggccgagggttttgccgatcatatggcg
gcggcgggaatccttgtatcgggccgatacgggcagcagcgctgggtgacccataaggat
atcggcgacgaggcgatcgaggcggcgctggacgcggcggaaaaattcttctcgggacgg
tga

DBGET integrated database retrieval system