KEGG   Pelagibacterium halotolerans: KKY_2524Help
Entry
KKY_2524          CDS       T01645                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00071  Fatty acid degradation
phl00280  Valine, leucine and isoleucine degradation
phl00310  Lysine degradation
phl00362  Benzoate degradation
phl00380  Tryptophan metabolism
phl00620  Pyruvate metabolism
phl00630  Glyoxylate and dicarboxylate metabolism
phl00640  Propanoate metabolism
phl00650  Butanoate metabolism
phl00900  Terpenoid backbone biosynthesis
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01120  Microbial metabolism in diverse environments
phl01130  Biosynthesis of antibiotics
phl01200  Carbon metabolism
phl01212  Fatty acid metabolism
phl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KKY_2524
   00630 Glyoxylate and dicarboxylate metabolism
    KKY_2524
   00640 Propanoate metabolism
    KKY_2524
   00650 Butanoate metabolism
    KKY_2524
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KKY_2524
   00072 Synthesis and degradation of ketone bodies
    KKY_2524
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KKY_2524
   00310 Lysine degradation
    KKY_2524
   00380 Tryptophan metabolism
    KKY_2524
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KKY_2524
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KKY_2524
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KKY_2524
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phl04147]
    KKY_2524
Enzymes [BR:phl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KKY_2524
Exosome [BR:phl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KKY_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEQ52532
UniProt: G4RA05
Position
complement(2513963..2515249)
Genome map
AA seq 428 aa AA seqDB search
MTLTLRKVAIVGSARIPFCRAYTGYENETNLSMLSTAIGGLADKYGLKGQRVGEVMAGSV
ISHSKDFNLAREALLDAGLSPQTPGTTVQIACGTSLQAALMLGAKIATGEIDSGIAAGSD
TVSDSPVVLGPKMQKRMIALSRARTTGEKFSAFKGFNFGEIAPVAPSTQEPRTGLSMGEH
CELMAKQWGISREAQDLLALRSHQNAAAAYDAGFHDDLIVPCAGIYKDNNVRPDASLEKM
ATMKPAFDKKSGKGTLTAANSTPLTDGASSVLLASEDWARERGLPILGYLTMGAVSANDF
AHGDGLLMAPTIAVSDLMRRSGLGFADIDLFELHEAFAAQVLCTLAAWEDPDYNRAVLGR
DDPLGAVPVDKINVFGSSLAYGHPFAATGARILGMTAKLLNTQEKNRALISVCTAGGMGV
AAIVERAN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacactgacactgcgcaaagtcgccatcgttggatcggcgcgcatcccgttctgccgt
gcctatacgggttatgaaaacgaaaccaacctttcaatgctctcgaccgccatcggcggg
ctggccgacaagtacgggctcaagggacagcgggtcggggaggtaatggccgggtcggtc
atttcccattccaaggatttcaatctcgcgcgcgaggcgttgctcgatgcgggcctgtcg
ccgcaaacgccgggaacgacggtgcagatcgcctgcgggacatcgctgcaggcggcgctg
atgctgggagccaagattgccaccggcgaaatcgacagcggcatcgccgcgggctcggat
acggtttcggacagcccggtggtgctggggccgaaaatgcaaaagcgcatgatcgcgctc
tcgcgcgcccggacgaccggggagaaattttcggccttcaagggcttcaatttcggcgag
atcgcgccggtggccccctcgacccaggagcctcggacggggctgtcgatgggcgagcat
tgcgaattgatggccaagcaatgggggatttcacgcgaggcgcaggacctgctggcgctg
cgcagccaccagaacgccgcggccgcctatgatgcggggtttcacgacgatttgatcgtg
ccctgcgccggcatctacaaggacaacaatgtccggcccgatgccagccttgagaaaatg
gccacgatgaagccggctttcgacaagaaatcgggcaaagggacgcttacggctgccaat
tccacaccgctgaccgatggggcatcctcggtgcttctggccagtgaggattgggcacgg
gaacgcggtctgccgatccttggctatctgaccatgggagccgtttcggccaatgatttc
gcccatggcgacgggcttttgatggcgccgaccatcgcggtttccgacctgatgcggcgc
agcggtctgggctttgccgatatcgatctgttcgagttgcatgaggccttcgcggcgcag
gtgctttgcacattggccgcatgggaagatcccgactacaatcgggcggttttggggcga
gatgatcctctgggagcggtgcctgtggataaaattaacgtttttggctcttctctcgca
tatggccatccttttgccgcgaccggggcccgcattctgggaatgacagccaagcttttg
aatacacaagaaaaaaaccgggcgctgatttccgtctgcacggcgggcggcatgggcgtt
gcggcaattgtggaacgcgcaaattaa

DBGET integrated database retrieval system