KEGG   Pelagibacterium halotolerans: KKY_3111Help
Entry
KKY_3111          CDS       T01645                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00071  Fatty acid degradation
phl00280  Valine, leucine and isoleucine degradation
phl00281  Geraniol degradation
phl00310  Lysine degradation
phl00360  Phenylalanine metabolism
phl00362  Benzoate degradation
phl00380  Tryptophan metabolism
phl00410  beta-Alanine metabolism
phl00627  Aminobenzoate degradation
phl00640  Propanoate metabolism
phl00650  Butanoate metabolism
phl00903  Limonene and pinene degradation
phl00930  Caprolactam degradation
phl01100  Metabolic pathways
phl01110  Biosynthesis of secondary metabolites
phl01120  Microbial metabolism in diverse environments
phl01130  Biosynthesis of antibiotics
phl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KKY_3111
   00650 Butanoate metabolism
    KKY_3111
  Lipid metabolism
   00071 Fatty acid degradation
    KKY_3111
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KKY_3111
   00310 Lysine degradation
    KKY_3111
   00360 Phenylalanine metabolism
    KKY_3111
   00380 Tryptophan metabolism
    KKY_3111
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KKY_3111
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KKY_3111
   00281 Geraniol degradation
    KKY_3111
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KKY_3111
   00627 Aminobenzoate degradation
    KKY_3111
   00930 Caprolactam degradation
    KKY_3111
Enzymes [BR:phl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KKY_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEQ53101
UniProt: G4RGU8
Position
complement(3085388..3086443)
Genome map
AA seq 351 aa AA seqDB search
MDEISISIEGACGIIRLTRPKAINALSAEMIAAVRYALDEWDENEAVRTVLIEGEGEKGL
CAGGDVRRTREMAMAGETRAVFSFFADEYDMNGLIATYRKPIIAFQHGIVMGGGIGISSH
ARYRIATPTSRFAMPEGAIGFFCDVGVNAILYKTSEARALAFLLSGQTVGAADAIALGLA
DTVVPEDGLADLRGRVIEAAQAGDPDTAITALIQSESIDAGTADFCALSDSLAEIFAAPD
AEKIVEGLLDWSEDGDPGAAALYASIARHCPTALVAIVMSHRQARHKRDVRAILEDDLAL
ARYMSMRPDFAEGVRAVLVDKDKAPKWDPARLADVDIAALERVLGEAEAVG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatttccatttcgatcgaaggggcgtgcggcatcatcaggctgacccggccc
aaagcgatcaatgcgctgagcgccgagatgatcgcggcggtgcgctatgcgctggacgaa
tgggatgaaaacgaggccgtgcggaccgttctgatcgaaggcgagggcgaaaaggggctt
tgcgcgggcggcgatgtgcgcagaacgcgcgagatggccatggcaggggaaacccgggcg
gtcttttcgttctttgccgacgaatacgacatgaacgggctgatcgcgacctatcgcaag
cccatcatcgccttccagcacggcatcgtcatgggcggggggatcgggatttcctcgcat
gcgcgctacaggatcgcgacgcccacgagccggtttgccatgcccgaaggggctatcggg
tttttctgcgacgtgggggtcaacgccattctctacaagaccagcgaggcgcgggcgctg
gcgttcctgctttcggggcagacggtgggggcggccgatgcgattgcgctcgggctggcc
gatacggtggtgcccgaagatgggttggcggacttgcggggccgggtgatcgaagcggcg
caggcgggcgatcccgatacggcgatcaccgcgttgatccagtcggaatcgatcgatgcg
gggacggcggatttttgcgcgctttccgattcactggcggaaatttttgccgcgcccgat
gccgaaaaaatcgtcgaaggtctgctcgactggtccgaggatggcgatccgggcgccgcg
gcgctctacgcttcgattgcccgccattgcccgaccgcgcttgtggccatcgtcatgtcg
caccggcaggcgcggcacaagcgcgacgtgcgcgccattctcgaggacgatctggccctg
gcccgctacatgtccatgcgccccgatttcgccgagggggtgcgggcggtgctggtggac
aaggacaaggcgcccaaatgggacccggcacggttggccgatgtggatatcgcggcgctg
gagcgggtgctgggggaagcggaggcggtggggtag

DBGET integrated database retrieval system