KEGG   Pelagibacterium halotolerans: KKY_3800Help
Entry
KKY_3800          CDS       T01645                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00053  Ascorbate and aldarate metabolism
phl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    KKY_3800
Enzymes [BR:phl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     KKY_3800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind adh_short NmrA NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AEQ53782
UniProt: G4RD32
Position
3784557..3785375
Genome map
AA seq 272 aa AA seqDB search
MAKHYKRILLTGAAGRLGTELRKGLALLADHVRLADRTEIEDIQAHEEALTFDLSDEAAV
FEAVRDVDAIVHFGGAPLETAWKTVLSSNIEGSYNIYEAARRHGVGRVVYASSVHAIGYH
PLQAHIDTEAPVRPDSLYGVSKCFVESLSRLYWDKFGIESVCVRIFSSFPEPADRRMLWS
YLSFDDCVRLVSASLTAPHVGHTISFGLSDNALKPVDNARAGHLGYRPQDSSEPFRQAIE
ARTDPADPGAAATRFLGGWFCELGHPDDEAGK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcactacaaaagaattcttctcaccggagcagcaggtcgcctcggcaccgag
ctgcgcaagggcctggctctgctcgctgaccatgtccggctggcggaccggaccgaaatc
gaggatattcaggctcacgaagaagccctgacattcgacctttccgatgaggccgccgtg
ttcgaagccgtgcgggacgtggatgccatcgtccattttggcggcgcaccgcttgagacc
gcatggaagaccgtactgtcctccaacattgaggggagctacaacatctatgaggccgcg
cgtcggcacggcgtcgggcgcgttgtctacgcctcctcggtccacgccatcggctaccac
ccgctccaggcccatatcgacacggaagctccggtgcggcccgatagcctctacggcgtt
tccaagtgttttgttgaatccctgagccggctctattgggacaaattcggtatcgaaagc
gtgtgcgtgcgcattttctcatcctttcccgaaccggccgaccggcgcatgctctggtcc
tacctcagctttgacgattgcgtgcggctggtaagtgcgagccttacggcgcctcatgtg
gggcacaccatcagcttcggtctttccgacaatgcgctaaagccggtggacaatgccagg
gccggccatttgggttaccgtccccaggacagttccgaacccttccgccaggcgattgag
gccaggaccgatcccgccgatcccggtgccgccgcaacccgcttcctgggcggctggttc
tgcgagctcggtcaccccgacgacgaggccgggaaatga

DBGET integrated database retrieval system