KEGG   Phycisphaera mikurensis: PSMK_03700Help
Entry
PSMK_03700        CDS       T01800                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
phm  Phycisphaera mikurensis
Brite
KEGG Orthology (KO) [BR:phm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSMK_03700
Enzymes [BR:phm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     PSMK_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAM02529
UniProt: I0IB91
Position
complement(403970..404749)
Genome map
AA seq 259 aa AA seqDB search
MSGPAGHDLWFESDAGGGRDAPGTLGPLAAAAGLAGFALADRGTTAGLAAAAAGAAAAGV
GFLPGVTLDAEAAGLPVAVFGYGVDPDAEPLRAALAEAGEAQRLRFAAVRAALEAAGIRL
PADRPPDAAALVAAGFAPSRHAATRRYLGPGGVAHVAADRPPAAEVSAAVRGAGGRAFLR
PGPELAADAEGLEHAVARLAASDMAGLVATTRAEHTAWSAVAGRLGLCVVGGSGYRGAGR
GPEPGAATTDAPLWHALTR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggccccgccggccacgacctctggttcgagagcgacgccggcggcggccgcgat
gcacccggcacgctcggcccgctcgcggccgccgcgggcctcgccggcttcgcgctcgcc
gaccgcgggaccaccgccggcctcgccgccgcggcggcgggcgccgcggcggcgggggtc
ggcttcctgcccggcgtgacgctcgatgccgaagccgcgggcttgcccgtcgcggtcttc
ggctacggcgtcgaccccgacgccgagccgctacgtgccgcgctcgccgaggccggcgag
gcgcagcggctgcgtttcgcggccgtgcgtgccgccctcgaagccgccggcatccgcctc
cccgccgatcggccccccgacgccgcggccctggtcgccgcgggctttgcccccagccgc
cacgccgcgacgcgccgctacctcggccccggcggcgtggcccacgtcgccgcggaccgg
ccgcccgcggcggaggtttcggccgcggtccgcggcgccgggggccgagccttcctgagg
ccggggccggagctggcggcggacgccgaaggcctcgagcacgcggtcgcgcggctggcc
gccagcgacatggccggcctcgtcgccacgacccgggcggagcacaccgcctggtcggcg
gtcgcgggccgcctcggcctctgcgtggtcggcggcagcggctaccgcggcgccggccgc
gggcccgagcccggggccgcgacgacggacgccccgctgtggcacgcgctcacccgctga

DBGET integrated database retrieval system