KEGG   Phycisphaera mikurensis: PSMK_12480Help
Entry
PSMK_12480        CDS       T01800                                 

Gene name
gdh
Definition
(GenBank) putative glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00030  Pentose phosphate pathway
phm01100  Metabolic pathways
phm01120  Microbial metabolism in diverse environments
phm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:phm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSMK_12480 (gdh)
Enzymes [BR:phm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     PSMK_12480 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR PALP AA_kinase Epimerase
Motif
Other DBs
NCBI-ProteinID: BAM03407
UniProt: I0IDR9
Position
complement(1470186..1470968)
Genome map
AA seq 260 aa AA seqDB search
MHTSLKNRRVLVTGGSAGIGQAIARSAARAGADVAFNHLGDDAGAAETADLIEGFGRRCW
HESSDIAEEAQVIAMFRKLDEAWGGIDILVNNAGVDGHRGLLWEMDPAEIRRVLDINFHG
VIHACRSAVPRMIGRGHGVICNITSVHDKVPWSGYTPYCAAKAAVAAMTQSMTLELADSG
VRAFCIAPGAIKTNTKSHKHLDEAAHNDLLSKIPSGRVGNAEEVGDMVVALCSPAGDYVA
GTSVYVDGGMTCYPSFMTGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcatacctcgctgaagaaccgaagggtcctcgtcaccggcggcagcgccgggatcggc
caggccatcgcccgctccgccgcccgcgccggcgccgacgtcgccttcaaccacctcggc
gacgacgcgggcgccgccgagaccgcggacctcatcgagggcttcgggcgccggtgctgg
cacgagagcagcgacatcgcggaggaggcgcaggtgatcgcgatgttccggaagctcgac
gaagcctggggcgggatcgacatcctcgtgaacaacgccggcgtcgacggccaccggggg
ctgctctgggagatggatcccgcggagatccgccgggtgctcgacatcaacttccacggc
gtcatccacgcctgccgctccgcggtgccgcggatgatcggccgcggccacggcgtgatc
tgcaacatcaccagcgtccacgacaaggtgccctggtccggctacacgccctactgcgcc
gcgaaggcggcggtcgccgcgatgacgcagtcgatgaccctggagctggccgactcgggc
gtccgcgccttctgcatcgccccgggcgccatcaagaccaacacgaagagccacaaacac
ctcgacgaggcggcccacaacgacctcctgtccaagatccccagcgggcgcgtcggcaac
gccgaagaggtcggcgacatggtcgtcgcgctctgctcccccgcgggcgactacgtcgcg
ggaaccagcgtctacgtggacggcgggatgacctgctaccccagcttcatgaccggcggc
tga

DBGET integrated database retrieval system