KEGG   Phycisphaera mikurensis: PSMK_25680Help
Entry
PSMK_25680        CDS       T01800                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00540  Lipopolysaccharide biosynthesis
phm01100  Metabolic pathways
Module
phm_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:phm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PSMK_25680 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:phm01005]
    PSMK_25680 (hldD)
Enzymes [BR:phm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     PSMK_25680 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:phm01005]
 Unusual sugar
  PSMK_25680 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAM04727
UniProt: I0IHI9
Position
3066685..3067680
Genome map
AA seq 331 aa AA seqDB search
MAAPQRILVTGGAGFVGSRLVKKLQETIPGVDLLVVDDFRTGTFANLSEEGKRGWSYRGR
VIAYPLHEVDIDGLIEDFEPDAVYHEASITDTTVEDEAAMIRDNVEPFEALLAVCLEREI
PLVWVSSAATYGTQASGATAERRLFKPDDAGRPANVYGFSKWVMENAQRRLMPHFPDGHV
VGLRYFNVFGPGEANKGHMASMIRQLALQMLDGKRPRIFAPGTQARDHVHVSDVVDATIA
AARPGARSGIYNVGTGEATSFNQVVDALNEALGTDLQPEYFDNPFRFYQDHTQADLAETR
EALKWKPRFSTAEGIKHYAGILKSEREENRG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccgcaacgcatcctcgtcaccggcggcgccggcttcgtcggctcccggctc
gtcaagaagctccaggagacgatccccggcgtcgacctcctggtggtggacgacttccgc
accgggaccttcgcgaacctctccgaggaggggaagcggggctggagctaccgcggccgg
gtgatcgcgtacccgctgcacgaggtcgacatcgacgggctcatcgaggacttcgagccc
gacgccgtctaccacgaagcctccatcaccgacaccacggtggaggacgaggcggcgatg
atccgcgacaacgtcgagcccttcgaagcgttgctggccgtgtgcctcgagagagagatc
ccgctggtctgggtgtcgtcggcggcgacctacgggacgcaggccagcggggcgaccgcg
gagcgacggctgttcaagccggacgacgccggacggccggcgaacgtctacggcttctcc
aagtgggtgatggagaacgcccagcggcggctgatgccgcacttccccgacgggcacgtc
gtcgggctgcgctacttcaacgtgttcgggccgggcgaggccaacaaggggcacatggcg
tcgatgatccggcagctggccctgcagatgctcgacggcaagcggccgcggatcttcgcc
ccgggcacgcaggcccgcgaccacgtgcacgtgagcgacgtggtggacgcgacgatcgcg
gcggcgcggcccggggcgcgaagcgggatctacaacgtgggcacgggggaggcgacgagc
ttcaaccaggtggtggacgccctcaacgaggcgctgggcaccgatctgcagccggagtac
ttcgacaaccccttccgcttctaccaggaccacacgcaggcggacctcgccgagacgagg
gaggctctcaagtggaagccccgcttctcgaccgcggaggggatcaagcactacgcgggg
atcctcaagagcgagcgggaggagaaccgggggtga

DBGET integrated database retrieval system