KEGG   Paenalcaligenes hominis: PAEH1_06885Help
Entry
PAEH1_06885       CDS       T04704                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
phn  Paenalcaligenes hominis
Pathway
phn00970  Aminoacyl-tRNA biosynthesis
phn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PAEH1_06885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phn03029]
    PAEH1_06885
Enzymes [BR:phn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PAEH1_06885
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PAEH1_06885
Mitochondrial biogenesis [BR:phn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PAEH1_06885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AQS51349
UniProt: A0A1U9K068
Position
1365230..1366741
Genome map
AA seq 503 aa AA seqDB search
MSFFTQFSDIATMGAALRAGKTSARELTQDALSAIAQSQLNAFIQVDADLSLAQADHADA
LLQSGKATPLTGIPIAHKDVIVTQHWRTTAASKMLANYVSPFDATLVTQLQQAGAVSLGK
LNCDEFAMGSDSTSSYFGPTKNPWNLSRTPGGSSGGSAAAVAAGLIMAATGSDTGGSIRQ
PAAHCGITGIKPTYGTVSRYGVIAYASSMDQAGPLARSAKDALALLEVMSGFDANDPTSL
EQCGKQKNTGVRVRDQFTAHSDQFDAHGDQPLKGVRIGVPTEFFTRLSDADSIAAIESAL
ALYESLGATRVEVSLPRTQQAVPAYYVITPAEASSNLSRFDGVRFGHRSDTYHDLQSMIS
NSRTEAFGPEVVRRILTGTYVLCEGYYDAYYLQAQRVRRLIANDFQSAFEQCDVIMGPVT
TKPAQSLDHQDADPTADWREDVFTLCANLAGLPAMSHPCGFTAQHLPIGLQLIGNYFNEG
QLLAIADRFQQHSDWHQRIAGTK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctttacccagttttctgacattgccacgatgggagcggcattacgtgctggt
aaaaccagcgcacgcgagctaactcaagacgcacttagcgctattgctcaaagccagctc
aatgcatttattcaagtcgatgccgacctcagtctagcccaagccgaccacgcagatgcg
ttactccaatccggtaaagccacgcccttaaccggtattcctattgctcacaaagatgta
attgtgacgcagcactggcgtacgacagcagccagtaaaatgttggcgaattacgttagc
ccctttgatgccaccctagtgacccagttacagcaagccggtgccgtctctttaggtaaa
ctcaactgtgacgagtttgccatgggctctgacagtaccagctcgtattttggtccaaca
aaaaacccatggaatctgtcccgtaccccgggtggctcatcgggtgggtcagcggccgca
gtggctgcgggtttaattatggcagcaactggctcggatacaggcggctccattcgtcaa
cccgcagcccattgtggtattactggtatcaagcccacgtatggcacggtgtcacgctat
ggcgtcattgcctacgcctctagcatggatcaggccggccccctagcacgcagcgctaaa
gatgcattggctctcttagaggtgatgtcaggctttgatgccaacgatcccaccagcctc
gagcagtgcggcaagcaaaaaaacactggcgtccgcgtacgtgatcaattcacggctcat
agtgatcagttcgatgcacacggcgaccagcccttaaaaggcgtacgtattggcgtgcct
accgagtttttcaccagactgtccgatgcggatagcatcgccgccattgaaagcgcgcta
gctctttacgaatccttgggtgccacacgcgtagaggtttcgttaccacgcactcagcag
gcggtacccgcgtattacgttatcacccccgccgaggcctcaagcaacctatcacgcttt
gatggcgttcgttttggtcaccgttctgacacttatcacgatctacaaagcatgatcagc
aatagtcgtaccgaagcctttggtcccgaggtcgtacgtcgcattttgaccggcacctat
gtgctttgcgaaggctattacgatgcctactatctccaagcgcaacgtgtacgccgctta
attgctaacgattttcaatctgctttcgagcagtgcgatgtcatcatgggtccggtgact
accaagccagcgcagtccttagaccaccaagacgctgacccgactgccgattggcgcgaa
gacgtttttactttgtgcgctaacttagcagggctccctgccatgtcgcacccatgcggc
tttacagctcaacaccttccgattggcttgcaactgattggcaattactttaacgaaggt
cagcttctcgctatcgcagatcgctttcaacaacacagcgattggcatcaacgcattgca
ggaacaaaataa

DBGET integrated database retrieval system